KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2689Help
Entry
VC2689            CDS       T00034                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC2689 (pfkA)
   01230 Biosynthesis of amino acids
    VC2689 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC2689 (pfkA)
   00030 Pentose phosphate pathway
    VC2689 (pfkA)
   00051 Fructose and mannose metabolism
    VC2689 (pfkA)
   00052 Galactose metabolism
    VC2689 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VC2689 (pfkA)
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VC2689 (pfkA)
Protein phosphatases and associated proteins [BR:vch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VC2689 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(2856783..2857778)
Genome map
AA seq 331 aa AA seqDB search
MIFDSQSSRVSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDR
IKQLDRSSVSDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMG
AKKLTEMGFPCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEI
MGRHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDAN
KLAKEIESATGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQK
EQLVHHDIIDAIENMKRPVRTDLYKVAEELF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcgattcgcaaagttcgagggtgagcatgattaaaaaaatcggtgttttgacg
agtggtggcgatgccccaggtatgaatgcagctattcgcggcgtggtgcgtacagcactt
ggcgcaggtttagaagtgtttggtatttacgacggctaccaaggtctgtacgaagatcgt
attaagcagctagaccgttcaagcgtgtctgacgtgatcaaccgtggcggtactttttta
ggctctgcacgcttcccacaatttcgtgaagttgaagtgcgcgaaaaagcgattgaaaac
ctgaaaaagcacggcattgaagcgctggttgtgattggtggtgacggctcttacatgggc
gccaaaaaactgaccgaaatgggtttcccttgtatcggtctgccaggcacgattgataac
gatatcgcgggcaccgactacaccatcggttatttgactgccctgaacaccgttattgaa
gcgattgaccgtctgcgcgatacctcttcttcacaccaacgtatctctatcgtagaaatc
atgggtcgtcactgtggtgacttgacgctgacctctgcgattgcgggtggctgtgaatac
atcatcacaccggaaacgggtctgaatatggagcagctgatttccaatatcaaagatggt
attgcgaaaggcaaaaagcacgcgatcattgcgctgactgagctgatgatggatgccaac
aaactggccaaagagattgaatcggcgacaggccgtgaaactcgcgcaactgtattaggc
catattcaacgtggtggtaaacctaccgcatttgaccgtgtactggcatcgcgcatgggt
aactacgcggtgcatctattgatggaaggtcacggtggtcgttgtgtgggtatccagaaa
gagcaactggttcaccacgacatcattgatgcgattgaaaacatgaagcgtcctgtacgc
actgacctgtacaaagtcgctgaagagctgttctaa

DBGET integrated database retrieval system