KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0606Help
Entry
VCA0606           CDS       T00034                                 

Definition
(RefSeq) phosphonoacetaldehyde hydrolase
  KO
K05306  
phosphonoacetaldehyde hydrolase [EC:3.11.1.1]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    VCA0606
Enzymes [BR:vch01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.1  phosphonoacetaldehyde hydrolase
     VCA0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:544015..544830
Genome map
AA seq 271 aa AA seqDB search
MMNSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQGFDFEISLAEAREPMGLGKWQHIEA
VGKLPTVAQRWQKQFGRPMQASDIDAIYAAFMPLQIAKVADHAAPIPHSLEVVEQIRSRG
IKIGSCSGYPRQVMDVLIAAAADYGYRPDYVVATDDLAQGGRPAPFMALKNVIELGVTDV
RACVKVDDALPGIEEGHNAGMWTVGLLLSGNEAGLTLEEYQHADDQTLQAARERAQAKLQ
QAKPHYLIDTVADLPAVLAQIEQRLLAGERP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactctccgattcaagccgttattttcgattgggctggcactattgtggatttt
ggatcctttgcgccgacctcgatttttgttgaagctttcaagcaaggctttgattttgag
attagccttgccgaggctcgcgagccgatgggactgggcaaatggcagcacattgaagcc
gtcggaaaactcccaaccgttgcgcagcgctggcagaagcaatttggacgcccgatgcaa
gccagcgatattgatgcgatttacgccgcctttatgccgctgcaaatcgccaaagtcgcc
gatcacgctgcaccgattcctcactcacttgaagtggttgagcagatccgatcgcgcggg
atcaaaatcggctcttgctctggttatccacgccaagtgatggatgtgctgatcgctgcg
gctgccgattacggttatcgtcctgattatgtggttgctaccgatgatttagcgcaaggt
ggccgccccgccccttttatggcactcaaaaatgtcattgagcttggcgtgaccgatgta
cgcgcttgtgtgaaagtcgatgatgccctgcccggcatcgaggaaggtcataatgcgggg
atgtggacggttggtttactgctgtcaggcaacgaagccgggttaacccttgaagagtac
caacatgctgatgaccaaacgctacaagcggcgcgcgaacgtgcacaagccaaactgcaa
caggcaaaaccgcattatttgatcgatacggttgcagacttgcctgccgtgctcgcgcaa
attgagcaaagattattagccggtgaacgcccttaa

DBGET integrated database retrieval system