KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0607Help
Entry
VCA0607           CDS       T00034                                 

Definition
(RefSeq) nucleoside diphosphate kinase regulator
  KO
K06140  
regulator of nucleoside diphosphate kinase
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Transcription factors [BR:vch03000]
 Prokaryotic Type
  Other transcription factors
   Others
    VCA0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:544995..545402
Genome map
AA seq 135 aa AA seqDB search
MSQLNTIVVSTRDMDRISQLMDNLATLSPELEKLEEELDRATVLEPAEMPEDVVTMNSTV
RFKFLGSDEVMEKTLVYPNDVKSSADVSIFAPVGSALLGLAVGQQLAWPMPGGTLKTLEI
IDIVYQPERAGEFHR
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacttaatactatcgtggtgtccactcgcgatatggacagaatcagccagttg
atggataacctagccactttgtcgccagagctagagaaactggaagaagaattggatcgc
gccactgtgctcgaacctgcagagatgccagaggatgtcgtcactatgaattctacggtg
cgctttaaatttttgggcagcgatgaagtgatggaaaaaaccttggtgtatccaaacgat
gtgaaaagcagcgcggatgtttcgattttcgcccctgtgggaagcgcattgcttggttta
gcagtcggtcaacaactggcttggccaatgccgggcggtactctcaaaaccctcgaaatc
atcgatatcgtctatcaacctgaacgcgctggcgaattccaccgttaa

DBGET integrated database retrieval system