KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0608Help
Entry
VCA0608           CDS       T00034                                 

Definition
(RefSeq) nucleotidase
  KO
K08723  
5'-nucleotidase [EC:3.1.3.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VCA0608
   00240 Pyrimidine metabolism
    VCA0608
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VCA0608
Enzymes [BR:vch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     VCA0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(545462..546136)
Genome map
AA seq 224 aa AA seqDB search
MKYDWILFDADETLFHFDAFKGMQLMFARKGVEFTEQDFHQYQEVNKPLWVDYQNGDITA
AQLKHTRFAGWAEKLNTTTDELNSAFLQAMADICTLLPGAMELMQALQGKARLGIITNGF
TELQDVRLAKTGMTDFFDQIVISEEVGIAKPDAGIFAHALERMGNPTKSRVLMVGDNPHS
DILGGLNFGIETCWLNVHQHPKPDGITPHYEVTSLHELREILLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgattggatcttatttgacgctgacgagaccttgtttcatttcgatgctttt
aaaggcatgcagctgatgttcgcgcgcaaaggcgtggaatttaccgaacaagattttcac
caataccaagaagtgaataaaccgctgtgggtggattaccaaaacggcgatattactgcc
gcgcagctcaaacatacgcgctttgcgggttgggctgaaaagcttaataccaccactgac
gagcttaatagtgcatttttacaagccatggcggatatttgtaccttgctaccgggcgcg
atggagttgatgcaggcgctacaaggtaaagcgcgtttgggcattatcaccaacggtttt
accgagctacaagatgttcggctggctaaaaccggcatgactgacttttttgatcagatt
gtgatttctgaagaagtcgggattgctaaacccgatgctggcatttttgcccacgcacta
gagcgtatgggcaacccaaccaaaagccgagtgctgatggtcggggataatccacattct
gacattctaggtggcttgaattttggcatcgaaacttgctggctcaatgttcatcagcac
ccgaaaccagatggcattacgccacattatgaagtgacttcactgcatgaactgagagag
attttgttggcgtaa

DBGET integrated database retrieval system