KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0623Help
Entry
VCA0623           CDS       T00034                                 

Definition
(RefSeq) transaldolase B
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00030  Pentose phosphate pathway
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
vch01230  Biosynthesis of amino acids
Module
vch_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vch_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VCA0623
Enzymes [BR:vch01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     VCA0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 2612553
NCBI-ProteinID: NP_233012
UniProt: Q9KLW8
Position
II:557117..558067
Genome map
AA seq 316 aa AA seqDB search
MSNKLAQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAEYAPLIDQAIAYAK
TQSNDKAQQVQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDTERSVAKARQLVKMYN
DAGISNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISPFVG
RIMDWYKAKEGRDFAASEDPGVLSVTKIYNYYKEHGYKTVVMGASFRNIGEILELAGCDR
LTIAPSLLAELEAAEGELVAKLVDSKGSKARPAPMTHSEFLWEHNLDAMAVEKLAEGIRN
FAVDQGKLEAMIAAKL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaattagcgcaacttcgtaaactgaccacagtcgtggccgacactggtgaa
attgatgcaatcaaaaaataccagccagaagacgcaaccactaacccttctctgattctt
aaagctgcgcagattgctgaatacgcacctctgattgatcaagctatcgcctacgcaaaa
actcaaagcaacgacaaagcacaacaagtacaagacacttgtgacatgctggcggtcaac
atcggtaaagaaatcctaaaaaccattcctggccgtatttcgactgaagttgacgcgcgt
ctttcttacgacaccgagcgcagcgtagcgaaagcacgtcagctagtaaaaatgtacaac
gatgcgggcatcagcaacgatcgtatcctgatcaaactggcttctacttgggaaggtatc
cgcgcggcggaaattcttgaaaaagaaggcatcaactgtaacctgactctgctgttctct
ttcgcacaagcgcgtgcgtgtgctgaagcaggcgtgttcctgatctctccattcgttggc
cgtatcatggactggtacaaagctaaagaaggtcgtgatttcgcggcaagcgaagaccca
ggcgtactgtcagtcaccaagatctacaactactacaaagagcatggctacaaaacggtt
gtgatgggtgcaagcttccgtaacatcggcgagatcctagaactggctggctgtgaccgc
ctgactatcgcaccttcgctactggctgagcttgaagcggctgaaggcgaattggttgcg
aaactggttgactcaaaaggctctaaagctcgccctgctccaatgacgcacagcgaattc
ctgtgggaacacaacctagacgctatggccgttgagaagctggctgaaggcatccgtaac
ttcgcggttgaccaaggcaaactggaagcaatgatcgcggctaagctgtaa

DBGET integrated database retrieval system