KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0625Help
Entry
VCA0625           CDS       T00034                                 

Definition
(RefSeq) TonB receptor-like protein
  KO
K16087  
hemoglobin/transferrin/lactoferrin receptor protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Transporters [BR:vch02000]
 Other Transporters
  Pores ion channels [TC:1]
   VCA0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(560275..562629)
Genome map
AA seq 784 aa AA seqDB search
MFVGARSLKSLLQIIDNNYQLHQYSCFIFDKDQIMQLKPLFTLLPVVLSSVVQAQENTEQ
AVDETVTVHGQSILTDQRTRSDLDKVRGIANADIFSGITSVQSNNMHNEAGALDIGIRGV
QGEGRVPIFIDGSLQSTHTSRGYQGVSDRTYIDTDLLSSLTVNKGATIESSPYASGAVGG
VVNATTLGIKDIIKDDQAFGVVLKARANNHNRTPDVSGDYSEQGQYALDERGEHSAFKHG
SLMLGLGYQAESFNTVLAYSKRSKGNHFAGKKGYEEYQEPVVGQGQEVVNTSFESDSWLF
KLASDTGTAHNADFNYRHHAQKAGEVLMAYWYKSSEDWEGNPYPDGKDRMPQWGLGTAKV
NTYSANYYYQPDHPWLNLNANFWYTEADLAQYNGLWALGTNAEQYFHAYHNDRSGLSLTN
ETLLTQWPVRLNYGLAQQNERLSPEEDGQTRFTKTVTSRHGKRTAQNLFANADIDYSPLR
VQLGLNLHNAKSTDYQTKQQLDYKEKLDLLSEFTYALTPSTQLFLKSSRTYRMPSLYETT
LSNEVFSYNPYNPIKPEQAWNNEVGVQFMASNSVLQDDRLNLSVSYFRNSIKDFISGGRL
AKTPGMSEWQANFTFTNYDKLQLSGWELGAHYQYAWLYTHFAATLYSETKICSVQQAQYA
ESDTCNSLGFAWGLTPTRIPPKQNLYLNVGTKFFNDTLDSGVKVSYHSGKSNPSDWLAGT
AANPILEIPSDYTIDLYSQYELNANTQLFFAINNVTDRYQVRPGSVVSMPDPGRTITLGF
EISY
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgggagcaaggtcactaaaatcattgttacaaattattgataataattatcaa
ttgcatcagtattcgtgctttatttttgacaaggatcaaattatgcagttgaaacctttg
ttcactcttcttcctgtcgttttgagtagtgtcgttcaagcacaagagaataccgagcaa
gccgtcgatgaaaccgttacggttcatggtcaatcgattctcaccgatcaacgtactcgt
tctgatttagataaagtgcgcggtattgccaacgcggatattttttccggcatcacgagt
gtgcagagtaataacatgcacaacgaagcgggggcattggatattggcatccgtggtgtg
cagggcgaggggcgtgtgccgatctttattgatgggagtttgcaatccactcacacctct
cgtggctatcaaggggtgagtgatcgcacttatattgataccgatttgctcagttcattg
accgtcaataaaggggcgaccattgagagttcaccttatgccagtggcgcggtgggcggt
gtggtgaatgccacaacattgggtatcaaagacatcatcaaagatgatcaagccttcggt
gtagtactgaaagcacgcgccaataaccacaatcggacgcctgatgtttcgggtgattat
tcggaacaaggccaatacgcgcttgatgagcgaggtgagcattctgcatttaaacacggt
tcacttatgcttggattgggctatcaggccgaatcattcaatacggtactggcgtacagt
aagcgttcaaaaggcaatcacttcgctggcaagaaaggttatgaggagtatcaagagcct
gttgttgggcaagggcaagaagtcgtcaataccagttttgagagtgactcttggctgttc
aaactcgcgagcgacactggcacggcacacaatgccgattttaattaccgtcaccatgcg
caaaaagcgggtgaagtgctgatggcgtattggtacaaatcttcagaagattgggaaggg
aacccataccccgatggcaaagacagaatgccgcagtgggggctaggaaccgccaaagtg
aatacctacagcgccaattactattaccaaccggatcatccttggctcaatttgaatgct
aacttttggtacaccgaggctgatctggcgcaatacaatgggctttgggcgctaggaacc
aacgcggagcaatattttcatgcatatcacaatgatcgctctggtctgagcctgaccaat
gaaaccttactgactcagtggccagtcaggctgaattatggtttggctcagcagaatgag
cgtttatctcctgaagaagatgggcaaacccgctttaccaagacggtgacttcccgccac
ggaaaacgtacggcgcagaacctgtttgcaaatgcggatatcgattactcgccgttgaga
gttcagcttggcctcaatctgcacaatgccaagtcaaccgattatcaaaccaagcagcag
ttagactacaaggagaagctcgatctgctcagtgagttcacctacgccttaacacccagc
actcagctgtttttgaaatcctcacgcacttaccgtatgccgagcttgtatgaaacgacg
ctatcaaatgaggtgttcagctataacccatacaacccgatcaaaccggaacaagcctgg
aacaatgaggttggcgtgcaatttatggcgtcgaacagtgtgctgcaggatgatcgtttg
aatctgtcggtgtcctatttccgcaacagtattaaagacttcatttcaggtggacgattg
gcgaaaaccccgggtatgtctgaatggcaggccaactttaccttcaccaattatgataag
ttgcaactctctggttgggagttaggtgctcattaccaatatgcttggttgtacacccac
tttgcggcgaccttgtacagcgagacaaagatttgttccgttcaacaagcgcaatacgcg
gagagtgatacctgtaattcgctcggatttgcatggggattaactccaacacgtattccg
ccaaaacagaatttgtacctgaatgtgggtacgaaattctttaacgatacgctcgattct
ggggtgaaagtttcttatcactcgggcaaatcaaaccctagtgattggttagcgggcacg
gcggccaatccgatccttgaaatcccgtccgattacacgattgatctctattcacagtac
gagttgaatgccaacacccagctgttctttgcgatcaacaacgtgaccgatcgttatcaa
gtgcgtccggggtctgtggtcagcatgccggatccggggcgaaccattacgctcggattt
gaaatctcttactaa

DBGET integrated database retrieval system