KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0630Help
Entry
VCA0630           CDS       T00034                                 

Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  
D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    VCA0630
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VCA0630
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     VCA0630
    1.1.1.399  2-oxoglutarate reductase
     VCA0630
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCA0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(567291..568262)
Genome map
AA seq 323 aa AA seqDB search
MKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSLSDETVLIERLKPFEALVLIRERTPIT
ENLLAHLPNLKLISQTGKVSNHIDVALCERYGVTVLEGIGSPVAPAELCWGLILAASRHL
PSYIEQLHAGHWQQNGGLGLGRTLSGHTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEAS
RQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAE
LVESGALYSVMQTNPTRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYF
QAAFENVVKFAHSAAKASLSDKA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcgattctggatgattaccaaaatgtggtgcgtggcttaaacgcctttcaa
tgcttacaagggcatgacgtcaccgtattcaatgacagcctgagtgatgaaacggtattg
attgagcgcctgaaaccttttgaggctttggtgctgatccgcgagcgcaccccaattact
gaaaatcttctggctcatctgccgaatttgaaactcatcagccagaccggaaaagtcagc
aaccatattgatgtggcactgtgtgagcgttatggcgtgacagtgttagaaggcatcggc
tctcccgttgccccagcggagctgtgctggggtttaatccttgccgcttcgcgccatttg
ccaagttatatcgagcagttacacgcaggtcattggcaacaaaatggcggattaggctta
ggtcgaaccctctctggtcacaccttgggcatttggggtttaggcaaaatcggtcagcgc
attgctcaatttggtcacgtatttggtatgccaatcttggtgtggggcagtgaagcctca
cgacaaaaagcgcttgagttgggctatcaagccgccgccgataaagccgagttttttgct
aaagccgatgtactttcactgcacttacgtttgaatgacgccacgcgtggcatcgttacc
aaacaagatctgctcgccatgaaacccgattcgctgtttgtgaataccagccgagctgaa
ctggtggagtcgggcgcactctactcagtgatgcagactaacccaacgcgccaagccgcg
gtcgatgtgtacgaaaacgagcccgcgttacccaacaatgagccgctgctgagtttgccc
aatgtgctgtgcgcgccgcatctcggttatgtggagaaaaacagctacgagatctacttt
caggccgcgtttgagaatgtggtcaagtttgctcactcggccgcaaaagcgtcactgagc
gataaggcctaa

DBGET integrated database retrieval system