KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0632Help
Entry
VCA0632           CDS       T00034                                 

Definition
(RefSeq) MutT/nudix family protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(568826..569275)
Genome map
AA seq 149 aa AA seqDB search
MSVEKTEPVEKTPTRLPVAECVSFLLVKEGSCLLERRSATKASDPNIIAIPGGHIEAGEN
QAQALQREVQEELGVDATRSVYLCSLYHPTEFELQLLHYYVVDQWQGEIACHEADEVFWT
PIAPSAVETIADKIAIQEFQRLYPRYLAL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtagaaaaaaccgagcctgtagagaaaacgccaacaagattgcccgtggcagaa
tgtgtctcttttttgctggtcaaagagggcagttgtctgctcgaacgtcgctcagcaacc
aaagcgagcgatcctaatatcatcgcgatccccggtgggcatatcgaagcgggagaaaac
caagcgcaagcgttgcagcgtgaagtgcaagaagagttaggcgtggacgctacgcgcagc
gtttatctctgctcgctttatcatccgacagaatttgagctgcaactgctgcactattac
gtggtggatcaatggcaaggtgagatcgcctgccacgaagcggatgaagttttttggacg
ccgattgcgccaagtgcggtggaaaccattgccgataaaatcgcgattcaagagttccaa
cgcctgtatccacgctatctggcgctgtaa

DBGET integrated database retrieval system