KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0633Help
Entry
VCA0633           CDS       T00034                                 

Definition
(RefSeq) membrane protein GlpM
  KO
K02442  
membrane protein GlpM
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(569315..569665)
Genome map
AA seq 116 aa AA seqDB search
MAALFFKCLLGALAVLIIALLSKTKSFFISGLVPLFPTFALIAHYIVGTERTMEDLRTTA
LFGLYSLIPYAAYLLAVYYFSYRLSLTGTLVCATLVWLVFAALLLVGWTRLHPSMA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttgtttttcaagtgcttgcttggagcgcttgcggtgttgatcattgccctg
ttatcgaaaaccaaaagcttttttatctccggccttgtgccgctatttcccacctttgct
ttaatcgcccattatattgttggcaccgaacgcactatggaagatctgcgcactaccgcg
ctgtttgggctgtattcgcttatcccgtatgcggcgtatcttcttgcggtgtattacttt
agttaccgcttgagccttactggcactctggtctgtgccaccttggtttggctggtattt
gctgcacttttactggtgggttggactcgtttacacccgagcatggcctaa

DBGET integrated database retrieval system