KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0635Help
Entry
VCA0635           CDS       T00034                                 

Definition
(RefSeq) LysR family transcriptional regulator
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:570592..571533
Genome map
AA seq 313 aa AA seqDB search
MKALNDLNLFVETARQGSFSKAANSLSLTTAAVSAAIRRLEEQVQFPLFVRSTRHIRLTH
EGEIFLAKTQTALATLQEGLDQIACARGQLAGQLHISAPSDLGRNLLLDWIDEFIALHPN
VTVKLDLSDRLTDMYANPVDIAIRYGQPADSNLVAMLLCDSNERVLCASPEYLAAHPPIL
HPDDLQHHNCLCFMLADTLHNKWILSRNGETHSVVVQGNPACNDGEVVHRLAVKGKGIAN
KSLMDISQDIIDGRLVRILPEWESGPVPIYMVCADRRLITPTIRAFQEFIREKGCQQRRA
VLTAIQEREQNPR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactcaatgatttgaatttgtttgtcgaaacggcgcgccaaggcagtttttct
aaagcggccaacagcctatcactcacgaccgccgccgtgagcgctgcgatccgccgcttg
gaagagcaagtgcaatttccgctgtttgtgcgctcaacgcgacatattcgtttaactcat
gagggcgaaatctttcttgccaaaacccaaaccgcgctggccaccttgcaagagggtttg
gatcagatcgcttgtgcgcgtggccagttggctggccaactgcacatcagcgcgccttca
gatttggggcgtaatttgctgctcgactggattgatgaatttatcgcgctgcacccgaat
gtcacggtgaaactggatctctctgatcgtctgacggatatgtacgccaatccggtcgat
atcgcgattcgttatggtcagcccgccgattccaatttagtcgccatgttgctgtgcgat
tctaacgagcgcgtattgtgtgcttcgccagagtatttggccgctcacccgcccattctg
catcctgacgatttacagcatcacaactgtctgtgctttatgctggccgatacgctacac
aacaaatggattttgagccgcaatggcgaaacgcacagtgtggtggtgcaaggcaaccct
gcctgtaatgatggcgaagtagtacacagattggcggtaaaaggcaaaggcattgccaat
aaatcgctgatggacatcagtcaggacattattgatgggcgtttagtgcggattttgccg
gaatgggaaagcggccctgtacccatttatatggtgtgtgccgatcgacgtttgatcact
ccaaccattcgcgcttttcaggaattcattcgtgaaaaaggctgccaacaacgacgtgcg
gtgctgacagccattcaagagcgagagcaaaatcctcgttag

DBGET integrated database retrieval system