KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0637Help
Entry
VCA0637           CDS       T00034                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00633  Nitrotoluene degradation
vch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    VCA0637
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     VCA0637
  1.-  
   1.-.-  
    1.-.-.-  
     VCA0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Cas_Csy1
Motif
Other DBs
NCBI-GeneID: 2612935
NCBI-ProteinID: NP_233026
UniProt: Q9KLV4
Position
II:complement(571824..572477)
Genome map
AA seq 217 aa AA seqDB search
MNIVQASQSRYSTKAFDASRKLSEQQVADLKELVRMSASSVNSQPWHFILAGSDEGKTRI
AKATQGGFSFNERKILDASHVMVFCAKTSIDDAYLLSLLDNEDKDGRFANEEAKTGMHGA
RSYFVNLHRENLNDAEHWMQKQVYLNVGTLLLGAAAMGIDAVPIEGFDAQVLNEEFGLTE
KGFNSVVIVPLGFHSEDDFNAKLPKSRWPAEAVFTEL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgtacaagcgtcgcagtctcgctattccaccaaagcgtttgacgccagccgc
aagctatctgaacagcaagtcgccgatctcaaagagttggtacgcatgagtgcctctagc
gtgaactcacaaccttggcattttattttggccggcagtgatgaaggcaaaacacgcatt
gccaaagctacgcagggcggtttttcgtttaatgagcgcaaaattttagatgcctcgcac
gtgatggtgttctgcgccaaaaccagcattgatgacgcgtatctgctctctctgctggac
aacgaagataaagatggccgttttgcgaatgaagaagccaaaaccggcatgcatggcgcg
cgtagctactttgtaaacttgcaccgtgaaaacctgaacgatgctgagcactggatgcaa
aaacaagtttacctcaacgtgggtacactgctgcttggtgctgcagccatgggcattgat
gcggtgccgattgaaggctttgatgctcaagtgctaaacgaagagtttggcttaaccgaa
aaaggcttcaacagtgtggtgattgtgccactaggtttccacagtgaagacgacttcaac
gccaaactgcctaaatcacgttggccggcggaagcggtctttaccgagctgtaa

DBGET integrated database retrieval system