KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0640Help
Entry
VCA0640           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K07112  
uncharacterized protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(576967..577431)
Genome map
AA seq 154 aa AA seqDB search
MVMNKLLFRATSLVAGLLFGLGMVVSGMADPAKVIGFLDVAGTWDPSLMFVMGGALAIFM
PAYFFLIKPKAKPVNAEVFCLANNTKIDRRLISGSVIFGLGWGLVGICPGPVVSSLALGN
LGAWVFFPAMMVGLGTTNLLICIRNRKESQTQTA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggttatgaataagctgttgtttcgagcaacttcgctcgtcgctggcctgttatttggc
ttaggaatggtggtatctggtatggcggatcccgctaaagtgatcggctttttggatgtg
gcaggcacttgggaccccagtttgatgtttgtgatgggcggcgcgttagcgatattcatg
cctgcttatttcttcctcatcaaacccaaagccaagcctgttaacgcagaagtgttttgt
ttggccaacaacaccaagattgatcgtcgcttgatctcaggctcagtaatctttggttta
gggtggggtttggtcggcatctgtccggggcccgttgtctcaagtcttgccttaggcaat
ctcggagcatgggtatttttccctgcgatgatggttggcttaggtacaactaatttattg
atctgtattagaaatcgtaaagaaagccaaacacaaaccgcctaa

DBGET integrated database retrieval system