KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0644Help
Entry
VCA0644           CDS       T00034                                 

Definition
(RefSeq) NADH oxidase
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:578595..580298
Genome map
AA seq 567 aa AA seqDB search
MTKIVIIGGVAGGASAAARARRLSEDAEIIMFERGPYVSFANCGLPYHIGGDIKERSNLL
LQTPESFLARFNVDVRTMNEVLRINRAAKTITVRNLLDQSEYDENYDFLLLSPGAGPVIP
PIPGIQNPLTHSLRNIPDMDKIIQTLQMNKPEHATVVGGGFIGLEMMEAFHHLGIKTTLI
EMADQVMTPVDREMAGFAHAEIRAKGIDLRLGAALKSVEYRPAATLPSAESGESLEHKHV
EGELDLLLSNGDTLTTDILIMAIGVRPETKLAAEAGLQLGELGGIWVNEQMQTSDPAIYA
VGDAVEEKDFVTGKQTLVPLAGPANRQGRMAADNMLGRNESYQGTQGTAICKIFDLAVAS
TGKNEKQLKREGIAYEKVYVHTASHASYYPGAEVVSFKMLFDPQTGKIFGAQAVGKDGID
KRIDVMAVAQRAGMTVEQLQHLELTYAPPFGSAKDVINQAAFVATNLIKGDAKAIHFDEI
DNLTDEQVLLDVRNPMELQNMGYLPGAINIPVDQLRQHMNELPKDKEIVIYCQVGLRGNV
AYRQLVNNGFKARNLIGGYRTYKFAKA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatagtgattattggtggtgttgcaggtggagcctcggcggcggctcgtgcg
cgtcgactcagcgaagacgctgaaatcatcatgttcgagcgtggcccctacgtttccttt
gccaactgcggcttgccatatcacatcggtggtgacatcaaagaacgcagcaatttgctg
ctgcaaacaccggaaagctttttagcacgttttaacgtggatgtgcgcaccatgaatgaa
gtgctgcgcattaatcgcgccgcaaagaccattactgtgcgtaatctgctcgatcaatct
gagtatgatgaaaactatgattttctgctgctctctcccggtgcaggtccagtcatcccg
ccaattccggggattcaaaacccactgacgcattcactacgcaatattccagacatggat
aagatcatccagacgctgcaaatgaataagcctgagcatgctaccgtggttggcgggggt
tttatcggtttagaaatgatggaagccttccatcaccttgggatcaaaaccacgctgatt
gaaatggccgatcaagtgatgacaccggtcgatcgcgaaatggcgggctttgctcacgct
gaaatccgagccaaaggcatcgatttacgattaggtgcggctttgaaatcggtcgaatac
agacccgccgccaccttaccgagtgcggaatcgggggaatcccttgagcataaacacgtg
gaaggcgaattggatttgctgctcagcaatggtgacacgctaactaccgacattctgatc
atggcgattggtgtacgcccagaaaccaaactggctgcggaagccggtttgcagctcgga
gaactcggtggtatttgggttaacgagcagatgcaaaccagcgatccagcgatttacgcg
gttggtgatgcggttgaagagaaagactttgtgacaggcaagcaaacgctggtaccactg
gcaggtcctgccaaccgtcaaggccgtatggccgcagataacatgcttggccgcaacgaa
agctaccaaggcacacaaggtactgcgatttgtaagatttttgatttagcggtcgcttcg
accggtaaaaatgaaaagcaacttaagcgtgaaggcattgcttacgaaaaagtgtatgtg
cacaccgcaagccatgcgagctactatccgggggcggaagtggtgtcgttcaagatgttg
tttgatccccagacaggcaaaatcttcggcgcacaagccgtaggtaaagatggcatcgat
aaacgcatcgacgtgatggcggttgcgcagcgtgcaggtatgacggttgagcagttacag
caccttgaactgacctacgctccaccgtttggtagcgcgaaagatgtgattaaccaagcc
gcctttgtcgccaccaacctgataaaaggtgatgcgaaagcgatccattttgatgagatt
gataacctcaccgatgagcaagtgctgctcgatgtgcgtaacccgatggagttacaaaac
atgggttatttgcccggcgcaatcaatattcctgttgaccagttgcgccagcacatgaac
gagctgccaaaagacaaagagattgtgatttattgccaagttgggttacgcggtaacgta
gcgtaccgtcaactggtcaataacggctttaaagcacgcaacctgattgggggttaccgt
acttacaagtttgctaaggcttaa

DBGET integrated database retrieval system