KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0647Help
Entry
VCA0647           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YHS FAP206
Motif
Other DBs
NCBI-GeneID: 2612266
NCBI-ProteinID: NP_233036
UniProt: Q9KLU4
Position
II:complement(582629..583075)
Genome map
AA seq 148 aa AA seqDB search
MKYWFGLILFFFSTFTMAQDPIYTGTFSNKALDGYDTVAYFTEGKPVKGAAQFKTEYQGA
EWLFASQQNLDAFLADPEKYAPQYGGYCAWAVSEKKDFAPGDPQYWAIEDGKLYLNYNNK
IKGLWEKDRAHHIAQGDQNWPALIGTSE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattggtttggtttaatcctgttctttttcagcacattcaccatggcgcaagat
ccgatttacactggcacgttcagcaataaagcgctggatgggtatgacacggtcgcttat
ttcaccgaaggcaaacccgttaaaggggccgcgcagtttaaaactgagtaccaaggtgcc
gagtggttgtttgcctctcaacaaaacctcgacgcgtttttagctgaccctgaaaaatac
gcgccgcaatatggtggctactgtgcatgggcggtgtctgagaagaaggatttcgcgcct
ggtgatccgcaatactgggccattgaagacggtaagctttatctgaactacaacaataag
attaaaggattgtgggaaaaagatcgggcgcatcatatcgctcaaggcgaccaaaattgg
cctgcgctgattgggacaagcgaatga

DBGET integrated database retrieval system