KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0650Help
Entry
VCA0650           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(584463..585599)
Genome map
AA seq 378 aa AA seqDB search
MTVLSPVACIAEHKVNAGMPLLVEAANERAISPFEFLPSWFCYAPVVVQSVLLGLYYRDL
RLPLVANPTIYLSGMVGESKHDILSLAGDQARRWISPFITCTVNDLPLTEQVKAIEQRLH
DADLRFPLVAKPDLGCRGVGVKLIQSHEQLSEYLRRFPVQARFLLQQKAPYSAEAGIFYV
RFPGDAQGQIISMTLKYAPSVMGDGVRTLRELIHACPRSGQLAHLYLPRHPDKLDWVVPD
KQEFQLAFAGSHSRGSIFRNGNRYITPALVEKLDAIFDDFPGFHYGRLDVKFSHIDALMR
GDAFTILEVNGASSEATHIWDRETRLGEIFTTLLKQYRILYAIGAEQKKRGHKPPSLRAL
LRAWRQEKQLIQHYPETD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacagttctttctcccgtggcatgtattgccgagcataaagtgaatgcgggtatgcct
cttttagttgaggccgccaacgaacgggcgatctcgccttttgaatttctgcctagctgg
ttttgttacgcgcctgtggtggtgcaaagtgtgctgctggggctttattaccgtgattta
cgtctgcctttggtggcgaatcccaccatttatttaagcggtatggtcggtgagtccaag
cacgatattttgagcctagctggcgaccaagcgcgacgttggatctcgccgtttatcact
tgcacggtaaacgatctgccgctcaccgaacaggtaaaagccattgagcaacgtttacat
gacgcagatttgcgctttcctttagtggctaagcccgatctcggttgtcgtggtgtgggg
gtaaaactcatccaatcccatgaacaactgagcgagtacctacgccgttttcctgtccaa
gcgcgttttcttttgcagcaaaaagcgccgtatagcgctgaagcggggattttctacgtg
cgttttcccggtgacgcgcaggggcaaatcatctcaatgaccttgaaatacgctccgagt
gtgatgggggatggcgtgcgtacgctgcgtgaattgatccacgcttgcccgcgatctgga
caactggcgcacctctatttaccacgccaccctgacaagctcgactgggttgttccggac
aaacaagagttccaattagcgtttgcgggcagtcacagccggggttcgatttttcgtaat
ggcaatcgctatatcacgcctgctttagtcgaaaaactggatgcgatatttgacgatttc
cccggttttcactacgggcgactcgatgtgaaattcagccatattgatgcgctcatgcgt
ggtgacgcgttcaccattcttgaggtcaatggcgcgagcagcgaagcgacgcatatatgg
gatcgcgaaacgcggctcggtgaaatcttcactacgctacttaagcaatatcggattttg
tacgcgattggcgctgagcagaaaaagcgaggccacaaaccgccaagtttgcgcgcttta
ttacgtgcttggcggcaggaaaaacaattgatccagcactatccagagacagattag

DBGET integrated database retrieval system