KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0655Help
Entry
VCA0655           CDS       T00034                                 

Definition
(RefSeq) sucrose-6-phosphate dehydrogenase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00052  Galactose metabolism
vch00500  Starch and sucrose metabolism
vch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VCA0655
   00500 Starch and sucrose metabolism
    VCA0655
Enzymes [BR:vch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VCA0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 2612580
NCBI-ProteinID: NP_233044
UniProt: Q9KLT6
Position
II:589860..591506
Genome map
AA seq 548 aa AA seqDB search
MLLDTLLELAGGINNVTRILAPQGQVVLALKHPPLVPHLPDDVSLQSVLGEWQLSVQRTA
EVSDQQLAAIGKAIAERQKLETLPYQTALDCPYRPLWHISPPQGLLNDPNGFIYHQGEYH
LFYQWHPFACEHKDKYWVHLKSLDLVDWQWQSVALTPSDWFDSHGVFSGHAVSHQQDLWL
FYTGNTRLGVDRQRQTMQCAARMNANGEFEKLGPVIRCLPEGVTEHIRDPKVIYTQGKWQ
MLLGAQTLAHQGRLAVYHSDDLLHWHFDKLYGDELGDYGYMWECPDWFELQGEAFFVFGP
QGIASANPHHTIEHQNRIFRATQNAQGEIALLQGWPLDEGFDFYAPQTAQTADGRRVLCG
WMGLPDETQHPSCDQGWIHQLTALRELEWREGRIYQHPLRELDTLQSEPHTLLLSDNVTE
LKTKSFALQVTLPWGCELRLMQNTQYRVTLTLDAENQLLRLDRSATQIRQGDTIRELKLD
SPTVELRILADQSSLEIFINQGEHVMTSRIFTPRDASGISLHGASVDAKLYYMAPASAPF
NLEVNVQP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgttattagatacgctgctcgaactcgcgggtggaataaacaatgtcacgcgcatttta
gctccacaggggcaagtggttttggcactaaaacatcccccgcttgtccctcaccttcct
gacgatgtgagtttgcaatcggtacttggagagtggcaactctctgtccaacgcactgct
gaagtgtccgatcagcaactcgccgcgataggtaaagcgattgccgagcgccaaaagctt
gaaaccctcccttatcaaacagccttagactgcccttatcggcccctgtggcatatctca
ccaccacagggcttactcaacgaccccaacggctttatttatcatcaaggggaataccac
ctcttttatcaatggcatcctttcgcttgcgaacacaaagataaatactgggtgcatctt
aagagcctcgatttagtcgattggcagtggcagtcggtcgccctgacaccttcggattgg
tttgatagccacggggtattctcaggtcatgcggtcagccatcaacaagatttatggctt
ttctataccggcaacacgcgcttaggcgtagatcgccaacgccaaaccatgcagtgcgcc
gcgcgcatgaacgccaatggtgagtttgaaaaattaggacctgtgattcggtgtttacct
gaaggcgtgaccgaacatatccgcgatcctaaagtgatttacacccaaggaaagtggcag
atgttacttggcgcgcaaacgctcgctcatcaaggacgactggcggtctaccactcagat
gacttactccattggcatttcgataagctctatggcgatgaacttggcgattacgggtat
atgtgggagtgtcctgactggtttgaactgcaaggtgaagccttttttgtgttcgggcca
caaggtatcgcatcggcgaatcctcatcacaccattgaacatcaaaatcggatctttcga
gcgacccagaatgcacaaggtgaaatagcgttactgcagggttggccattggatgaaggc
tttgatttttatgcaccgcaaaccgcgcaaactgccgatggacggcgagtattgtgtggc
tggatggggctacccgatgaaacgcagcaccctagctgtgaccaaggctggattcatcaa
ctgaccgcactccgtgaactagagtggcgtgaaggcaggatttatcagcacccattgcgt
gaactcgacacactgcaaagtgaaccgcacaccttgcttttgagtgacaacgtcactgag
ctaaaaaccaagagctttgctctgcaagtgactctgccttggggatgtgagctacgcttg
atgcaaaatacgcagtatcgcgtcacgttaacgttagatgcagaaaatcaactattacgc
ctcgatcgctctgcgactcaaattcgccaaggggacaccattcgggagctgaagctcgat
agcccaacggttgagctgcgcatcttggctgatcaatcctcattagagattttcatcaat
caaggcgaacatgtgatgaccagccgcatctttaccccacgtgatgccagcggtatttca
ttgcatggcgcgagcgtagacgcaaagctgtactacatggctcccgcatctgcgccattt
aacctagaagtgaatgtgcagccttga

DBGET integrated database retrieval system