KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0657Help
Entry
VCA0657           CDS       T00034                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VCA0657 (glpD)
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VCA0657 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:592946..594484
Genome map
AA seq 512 aa AA seqDB search
MNARSTRFTQDEVLDLIIVGGGINGAGIAADATGRGLKVGLYDAKDFASATSSASSKLVH
GGLRYLEHYEFRLVSEALAEREVLLKKAPHIVTPMRFRLPHRPFLRPAWMIRAGLFLYDN
LGKRTSLPASHKVNLKAGSVTKPEMQIGFEYSDCWVDDARLVILNAMQAQEQGAEVLNYC
TVEKAERMGDLWHVTLLDEQTQQRFERRSHALVNAAGPWVKQFLNENAHVSSPYGIRLIQ
GSHIIVPRIHDEPQAYILQNEDKRIVFVIPYLDDYSMIGTTDVEYKGDPRKVAITDAERD
YLISIVNKHFMREIARSDIIAEFSGVRPLCDDESNSPQAITRDYTLSLDQQADEAPLLSI
FGGKLTTYRKLGEAAMKHLAPFFPKMKAPWTADAPLPGGENFDYAALKNQLVAAFPFITE
SVIERWLRSYGSRTTQLLAGVTGIEDLGIAFSGELYQREIDYLCEKEFARHAQDIFWRRS
KLGLNHDTSVVEEVESYLQQKFHAEQPLKATV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcgctcaacacgttttacccaagatgaagtgctcgatttgattattgttggc
ggtggcattaatggcgctggcattgccgcagatgcaacagggcggggattaaaagttggc
ttatacgatgccaaagattttgccagtgcaacctcttccgccagctcaaaactggtacac
ggtggtttgcgctatttagaacattatgaatttcgcttagtcagtgaagcactggcggaa
cgcgaagtgcttttgaaaaaagcaccgcacatcgtaacgccgatgcgttttcgtttgcca
catcgtcctttcttacgcccagcatggatgatccgcgctggtctgtttctttatgataat
ttgggcaaacgcacttccctacctgcaagtcacaaagtcaacttaaaagcgggcagcgtg
actaaacctgaaatgcaaattggttttgagtattccgattgctgggttgatgatgctcgt
ttagttatcctcaacgccatgcaagctcaagaacaaggggcagaagtgttgaactactgc
accgtcgaaaaagctgagcgtatgggcgatttgtggcatgtgacgctactggatgagcag
actcaacaacgctttgagcgccgtagtcatgcacttgtgaatgccgcaggcccttgggta
aagcagtttttaaacgagaatgctcacgtcagttccccttacggcattcgtttaatccaa
ggctcacacattatcgtgccgcgcattcacgatgagccgcaggcctatattctgcaaaat
gaagataaacgtattgtcttcgtcatcccttatcttgatgactactcgatgattggcaca
acggatgtcgaatacaaaggcgacccaagaaaagtggcgattaccgatgctgagcgtgat
tatttgatttcgattgtgaacaaacattttatgcgcgaaatcgcgcgttcagacatcatt
gctgaattcagtggtgtacgcccactgtgtgatgacgaatcgaactcgccacaggccatt
actcgtgactatacactgtctctggatcaacaagctgatgaagcgccgctgctgtccatt
tttggtggcaaactcacgacgtatcgcaaactaggcgaagcggcgatgaaacatctcgct
cctttcttcccgaaaatgaaagccccttggacagcggatgctcctctgccaggtggtgaa
aactttgactatgcagccttaaaaaaccagctggtggcggcctttccttttattactgag
tcagtgattgagcgttggctccgcagctatggcagccgcaccacgcaacttttggcaggt
gtgacaggcattgaagatctcggcatcgcgttcagcggtgagctctaccaaagagagatc
gattatctgtgcgagaaagagtttgcccgccatgcacaagatattttctggcgcagaagc
aaactcggcttaaatcacgatacaagtgtggttgaggaagtggagtcctatttacagcag
aaattccacgctgagcagccgctaaaagcgaccgtttaa

DBGET integrated database retrieval system