KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0658Help
Entry
VCA0658           CDS       T00034                                 

Definition
(RefSeq) methyl-accepting chemotaxis protein
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCA0658
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VCA0658
Bacterial motility proteins [BR:vch02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    VCA0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(594586..596196)
Genome map
AA seq 536 aa AA seqDB search
MYTFALIKITLEQQAEMSAYTPSAQQEVLVGDHDQLVSTTDLKGVITYCNDTFCRIAGFQ
ADELLGKNHNIVRHASMPKAAFADMWHHLKQGHAWRGIVKNRTKSGGFYWVDAYVTPIYQ
QGQLTGYQSVRVKAERKWVEIATKAYQALLAAEKAGKKIQFKLHTSLRYALLLGALMSPA
LAHGFQAPEQWQWLASLLPAGVLGLLFRQELVRTPQQLKQWQNEYDSISRLIYSGADAFS
VADYHLKMASARIRTILGRMMDSARPLGELANQLHLTTQEVHQALAAQNSNIQAVTQATD
AVESAAERVSSHTHSAHQLIDQVQDHCAETKHSINVTHQNLQRLATQAESAALTTLKLSD
QAQQVGQLMTEIGGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALSARTQRATQQ
IQTSIDTMLSTIEAWRGDITASRDQTEQCAQDANTTLQQLQDVECVMSDMLRVIGEVASA
AQHQRELTCEVNQHIHSIASVATQNSAATHTVEQLAMAMSGKVAEFGALSKQFAQK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgtatacatttgcgctcataaaaataaccttagaacaacaagccgaaatgtcagcctat
actccctctgctcaacaagaagtccttgtcggcgaccatgaccaattggtatcaacgacg
gatttaaaaggtgtcatcacctactgtaatgatacattttgtcgtattgctgggttccaa
gccgatgagctgctaggaaaaaatcacaatatcgttcgccatgcttcgatgccgaaagcg
gcgtttgccgatatgtggcaccaccttaagcaagggcatgcttggcgcggaatcgtgaag
aatcgcactaaatccggcgggttttactgggttgacgcctatgtaacgccgatttatcaa
caaggccaacttacaggttatcaatcggttcgggtaaaagctgagcgaaagtgggtagag
attgccaccaaagcctaccaagcgttattagcggctgaaaaggccggtaaaaaaatccaa
tttaagctgcatacttcgctgcgttacgccttgttgctcggtgcattgatgtcaccagca
ttggcacatgggtttcaagctcctgaacagtggcaatggttagccagtcttttaccagcg
ggagtattaggtttgttgtttcggcaagagctagtgcgtaccccgcaacagcttaaacag
tggcaaaacgagtatgacagtatcagccgtttgatctattcgggcgctgatgctttttct
gttgccgactaccatctaaaaatggcttccgctcggattcgtaccattctcggtagaatg
atggactcggcgcgtccattgggtgaactggccaatcagctgcatttgacgacgcaagaa
gtgcatcaagcgttggcggcacaaaacagcaacatccaagccgtaacgcaggccaccgac
gctgtcgagagcgccgctgagcgggtttcgagccatactcactcggctcatcaattgatt
gatcaagtgcaagatcattgtgccgagaccaaacacagcatcaatgtcacccatcagaat
ttacagcgacttgccacgcaagctgagagtgctgccttgacgacactaaaactgagcgat
caagcgcagcaggtcgggcaattaatgactgaaattggcgggattgctgagcaaaccaat
ttactggcgttgaatgctgcgattgaagccgctagagcgggtgaacaaggtcgagggttc
gccgttgtggcggatgaagtgcgcgcattatcggctcgtacccagcgtgccacacagcag
atccaaaccagcattgatactatgttgtccactattgaagcgtggcgaggggatatcact
gcaagtcgtgatcaaaccgagcagtgcgctcaagatgcgaataccacgctgcagcagttg
caggatgtagaatgcgtaatgagtgacatgctacgagttatcggtgaggtggcgagtgct
gcgcaacatcaacgtgagctcacctgcgaggttaaccaacatatccactctatcgccagt
gtggcaacgcaaaattcggcggccacccataccgtagaacagttagcgatggcgatgagc
ggtaaagtggcagaatttggagcgctttcgaagcagtttgcacaaaaatag

DBGET integrated database retrieval system