KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0661Help
Entry
VCA0661           CDS       T00034                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like protein
  KO
K01802  
peptidylprolyl isomerase [EC:5.2.1.8]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Enzymes [BR:vch01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     VCA0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:597218..597691
Genome map
AA seq 157 aa AA seqDB search
MSKIIIPLVVFLLAGFMIYRTWTNHKSADANFSAGQQFLAENGQRENVITTDSGLQYEVL
QAGTGTEHPGPKSRVKVHYHGELLDGTVFDSSVERGEPISFGLNQVIKGWQEGVQLMVVG
EKTRFYIPSNLGYGKNGAGPIPPSAVLIFDVELLAIE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaattattatccctttagttgttttcttgctcgcaggtttcatgatttaccgt
acttggactaatcataagtcggcagatgccaatttttctgctgggcagcagtttttggct
gagaatggacaacgcgaaaacgtcatcactaccgatagtggtttgcaatacgaagtgctg
caggcgggaacggggactgaacatccggggccaaaaagccgcgtgaaagtgcattaccat
ggtgagttgcttgatggtacggtgtttgatagctcggttgaacgtggtgaacccatcagt
tttggcttgaatcaagttatcaaaggttggcaagagggcgtgcaactgatggtagtcggt
gaaaagactcgcttctatatcccaagcaacttgggttatggcaaaaatggcgcaggccca
atcccaccttctgctgtactgatctttgacgtcgagctactggcgattgagtaa

DBGET integrated database retrieval system