KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0667Help
Entry
VCA0667           CDS       T00034                                 

Definition
(RefSeq) sodium/solute symporter
  KO
K03307  
solute:Na+ symporter, SSS family
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(603572..605113)
Genome map
AA seq 513 aa AA seqDB search
MVTYSTFIVIAIYLILTILISWFVNQRSIGNTDFSTGGRQFGWFTAGVSILATYISAMTF
IGMPGWVYQSGMEALNIHLNYPIVIFFAVVFFIPVFYRMGFTSIYEYLEHRFGVYARTIN
SVVFILVQCISSGVILYAIALILIQILPISIVEAIVYITLFTACYTYAGGISTVIWTDML
QSAVLIAGSVAIFVLLLLQVDGVHGVSREQLNIINLQFDLGVDTTLWAGVVAVSFLHMSV
YGTNQLIIQRTLATRCEKTAQKSMLLCGYGAFFIYFFFALLGVLLSIFYQERHFTNSNEV
ILDFVFHHTNPWVIGLIISALAAAAMSTLDSTYNSMATVATFDLYQRFIRRNAPDHHYQA
VARKMSLVAAGLVVIPALLAVSNESVLKTIASLTSIFVGIRLGSFVLGLFSNQANEKGVI
AGSIISIAAVLGARLMDIAWPWFAPIGTVFFLVSGVVISRYWGDNSIQQQAFIARQKHLF
ATPTMSQYGLLVFAAVTIAVCAIIPDWLYNALS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggttacgtattcaacttttattgttatcgcgatttatctcatattgaccatactaatc
agctggtttgttaaccagaggagtattgggaatactgatttttcaactggtggaagacag
tttgggtggtttaccgcaggcgtttctattttagcgacatacatcagtgctatgactttt
attggtatgcctggatgggtttatcaatcgggtatggaagcgttaaacatccatttgaat
tatccgatagtcatttttttcgcagttgtattttttatccccgttttttatcgaatgggt
tttacgtccatttatgaatacttagaacaccgctttggtgtttatgctcgaaccattaac
tccgtggtattcatattggttcaatgtatttcgtctggagttattctttatgctattgca
ttgattttaattcagattttacccatatctattgttgaagcgattgtttacatcacttta
tttacggcttgttatacctatgctggtggtatctcgaccgttatctggacggatatgttg
cagtcagcagtattaattgcagggagtgtggcaatcttcgttctactcctccttcaagtc
gatggggtacatggagtatctcgggagcaactgaatatcatcaatcttcagttcgatttg
ggtgtcgacaccacattgtgggcgggagtggtggctgtcagtttcttacacatgagtgtg
tacggtaccaatcaattgatcatccaaagaacattagccacgagatgtgaaaaaacggca
caaaagtcgatgttactgtgcggttatggtgctttttttatttacttctttttcgctttg
cttggcgtcttattgagcattttttatcaagagcgacattttacaaacagtaatgaagtg
atacttgattttgtgtttcaccatacaaacccttgggtgataggtttaattatttctgcg
ctagctgcggcggcaatgtccactctggactctacctataattcgatggcaaccgttgcg
acgtttgatctttatcagcgctttattcgacgaaatgcacctgaccatcactatcaagcg
gtcgctcgtaaaatgagtttggtggccgcaggcttagtggtgatacctgctttgctcgcg
gtatcgaatgagtcagtgcttaaaacgatcgcgagtttaacctcgatttttgttggtatc
cgcctaggctcatttgttcttggtcttttttcaaatcaagccaatgagaaaggagttatc
gccggcagcataatcagtatcgccgccgtgcttggcgctagactcatggatattgcttgg
ccttggtttgctcctataggaaccgtgtttttcttggtatccggagtggtgataagccga
tactggggcgataattctattcaacagcaagcgtttattgcgcgtcagaagcatctcttc
gcaacgccgacgatgagccagtatggtttgttggttttcgcggctgtgacaattgcggtt
tgtgccatcatacctgattggctttataacgctttatcttaa

DBGET integrated database retrieval system