KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0677Help
Entry
VCA0677           CDS       T00034                                 

Definition
(RefSeq) nitrate reductase assembly protein NapD
  KO
K02570  
periplasmic nitrate reductase NapD
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:612218..612559
Genome map
AA seq 113 aa AA seqDB search
MDKLESKMSQPSASLHEVHISSLVVHTLPEHLLTVKQQVSELRDVEIYGEDPQGKLVVVI
ETDRQGFITETIEHINNLPNVLNAFLVFHQIETVTEEEQLHTGNTFSELEGNV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
gtggataaattggagagcaagatgtcacaaccctcagcttcactgcacgaagtacacatt
tccagcttggtggttcacaccttgccagagcatttgctcacagtgaaacagcaggtgagc
gagctgcgtgatgtggaaatttacggcgaggatccgcaaggcaaactcgtcgttgtgatt
gaaaccgatcgtcaaggcttcatcaccgaaaccatagaacatattaataatcttcccaat
gtgctcaacgcttttctggtgtttcatcagatagagacggtaacggaagaagaacaatta
cacactggaaataccttttctgaactcgagggtaatgtatga

DBGET integrated database retrieval system