KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0678Help
Entry
VCA0678           CDS       T00034                                 

Definition
(RefSeq) nitrate reductase catalytic subunit
  KO
K02567  
periplasmic nitrate reductase NapA [EC:1.7.99.-]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    VCA0678
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     VCA0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:612556..615045
Genome map
AA seq 829 aa AA seqDB search
MKMTRRAFVKANAAASAAAVAGITLPASATNLIASSDQTAIHWDKAPCRFCGTGCSVLVG
TQDGRVVATQGDPEAPVNKGLNCIKGYFLSKIMYGQDRLKTPLLRMKDGQYHKDGEFTPV
SWDTAFDVMAEKWKASLKTKGPTSVGMFGSGQWTVMEGYAAVKLMKAGFRSNNIDPNARH
CMASAVVGFMRTFGIDEPMGCYDDFEHADAFVLWGSNMAEMHPVLWTRITDRRLSHPHVK
VNVLSTYYHRSFELADHGYIFHPQSDLAIANFIANYIIQNDAVNWDFVNKHTHFKQAVTD
IGYGLRDDHPLQKKAKNANSGDVSDISFEEYKKSVAPYTVEKASEISGVSPDKLITLAKQ
YADPNTKVMSLWTMGMNQHTRGVWMQSLVYNLHLLTGKIATPGNSPFSLTGQPSACGTAR
EVGTFAHRLPADMVVANPKHRAIAEKVWKLPEGTIPEKPGFHAVQQDRMLKDGVLNCYWV
QCNNNMQAGPNINEERLPGYRNPENFIVVSDAYPTVTAQAADLVLPTAMWVEKEGAYGNA
ERRTQVWYQQVKTVGESHSDSWQVIEFSKRFKVEDVWPEELLAKAPQYRGKTLYDVLFKN
GQVDKFPLSEARELNDDAHHFGFYIQKGLFEEYAEFGRGHGHDLAPYDVYHQVRGLRWPV
VDGKETKWRFKEGSDPYAKAGSGWDFYGKPDGKAWIISSPYEAPPEMPNEEYDLWLCTGR
VLEHWHTGTMTRRVPELYKAVPDALCFMHHEDAQARGLRRGDEVLISNSRGEVRVRVETR
GRNKPPKGLVFVPFFDARILVNKLILDATDPLSKQTDFKKCPVKITKVA
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaccagacgtgcgtttgtgaaagcaaacgcagccgcctcagctgcggcggtt
gcagggatcaccctccccgcatctgccaccaacttgatcgctagctccgatcaaaccgca
attcattgggacaaagcaccttgccgtttttgtggtacaggctgttctgtgctggtcgga
acccaagatggtcgcgttgtcgccacacaaggtgatcctgaagctccagtaaacaaaggc
cttaactgcattaagggctacttcctctccaaaatcatgtacggtcaagatcgcttaaaa
acgccgctgctgcgcatgaaagatggtcaataccacaaagacggtgaattcaccccagtc
tcttgggataccgcatttgatgtgatggctgaaaaatggaaagcttcgcttaaaaccaaa
ggcccaaccagcgtgggtatgttcggttctggccagtggacagtgatggaaggttacgcg
gcggtgaagctgatgaaagcgggctttcgttctaacaacattgaccccaacgcacgtcac
tgtatggcttctgcggtagtgggctttatgcgtacctttggtattgatgagcctatgggc
tgttatgacgactttgaacacgccgatgcgtttgtgctttggggttccaacatggcggaa
atgcacccagtgctctggacgcgcattactgaccgtcgcctaagccatcctcatgtcaaa
gtgaatgtgctctcaacgtattaccaccgttcctttgagttggcggatcatggctacatt
ttccacccacagtctgacttagcgattgccaacttcatcgccaactacatcattcaaaac
gatgcggtgaactgggactttgtcaacaagcacacccatttcaaacaagcggtcacagac
atcggttacggtctgcgtgacgatcaccctctacagaaaaaggcgaaaaacgccaactcc
ggtgatgtcagcgatatttcgtttgaagagtacaaaaaatcggttgcgccttacacggtt
gaaaaagcgtctgaaatttccggagtatcaccggataaactgatcacgctcgcgaagcag
tatgccgatccaaacaccaaagtgatgtcactctggaccatggggatgaaccaacatact
cgcggtgtctggatgcaaagcttggtgtacaacctgcacttacttactggcaaaatcgcc
actccaggcaacagcccattctcactgaccggtcagccatcagcctgtggtacggcgcgt
gaagtgggtacctttgcacaccgtctgccagccgacatggtggtggctaaccctaaacac
cgtgcgattgccgaaaaagtgtggaaattgcctgaaggcacgattcctgagaaaccgggc
ttccatgcggtgcagcaagaccgcatgctcaaagacggcgtactgaactgttactgggtg
caatgtaataacaacatgcaagccggtccaaacatcaatgaagagcgtttaccgggctac
cgcaaccctgaaaacttcattgtggtatcggatgcttacccaaccgtaacggcgcaagcg
gctgaccttgttttgccaaccgccatgtgggtagaaaaagaaggcgcgtacggcaacgcc
gagcgccgtacccaagtgtggtatcaacaagtgaagactgtcggtgaatctcactccgac
tcatggcaagtgattgagttttcaaaacgcttcaaagtcgaagacgtgtggccggaagaa
ctgctggcaaaagcaccgcaataccgcggcaaaaccctgtatgacgtgctgttcaaaaac
ggtcaggtggacaagttcccactgagcgaagcacgtgaactcaacgatgatgcgcaccac
tttggtttctatatccaaaaaggtctgtttgaagagtatgccgagtttggccgcggccat
ggtcacgatttagcgccttacgatgtttaccaccaagtacgcggcctgcgttggccggtt
gtcgatggcaaagaaactaaatggcgctttaaagaaggctctgacccttatgccaaagcc
ggttcaggttgggatttctacggcaaaccggatggcaaagcgtggatcatctcctcacct
tatgaagcgccgccagaaatgcccaatgaagagtacgatttatggctctgtactggccgt
gttcttgagcactggcacactggcactatgacccgtcgtgtccctgagctgtataaagcg
gtaccggatgcgctgtgctttatgcaccatgaagacgcgcaagcgcgcggtttacgccgt
ggcgatgaagtgctgatctccaactcgcgtggtgaagttcgagtgcgcgtagaaactcgc
ggtcgtaataagccgccaaaaggcttggtgttcgtgcctttctttgatgctcgcattttg
gtcaacaagttaatcctcgatgcgaccgacccactctcgaagcagactgacttcaagaag
tgtccggttaagatcaccaaagtcgcgtaa

DBGET integrated database retrieval system