KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0683Help
Entry
VCA0683           CDS       T00034                                 

Definition
(RefSeq) sensor protein UhpB
  KO
K20263  
two-component system, NarL family, sensor histidine kinase FusK [EC:2.7.13.3]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Two-component system
Quorum sensing
Module
FusK-FusR (virulence regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCA0683
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VCA0683
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VCA0683
Protein kinases [BR:vch01001]
 Histidine protein kinases
  NarL family
   VCA0683
Two-component system [BR:vch02022]
 NarL family
  FusK-FusR [MD:M00818]
   VCA0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:618427..620010
Genome map
AA seq 527 aa AA seqDB search
MAKLFPLIFAFVLYSISQFSLWNVSQYLSHNPLQAYLLFPTGLRLAVYLLARPTYVWVWL
LSDMLLAGVILVLLPDQSSPLMLLMPWVVWLAAVIARQHWPKLHLYWQKLLLIVALVLLH
TILVGITFTLLAKPLHMGAETLIAVSIASLTGGIVLTPFLYLVADYLSHQTWHPLSPQLI
HHDVKLKPKMLMWSLLFFSLGLLAELTLLEQMKPFALLIILLPTIFLAYRYGWQGGVLAS
SLNCILLATARQFSGSFSSDQELLIFMSSQAFVGLGLGIAISRQHQLALLLQKMNTRLAK
ELREKQDLARQLVSVEEQIRKSVARELHDEIGQNITAIQIQSMLAERLASNDQAKQAASS
VQSLAMRIHQSTRQLLKQLRPHILDELGLEHAIRQLVQEMRFAEQGMTVRLNMGVNPQKL
DDTTRVTLYRIVQELLNNICKHAKATRVHISLFPGSEMVLEVKDDGIGLPTDWRVRGHGL
KGLSERVSALGGQLKMTSSTFQTGTRIIVNLPTKRSITSEKLGNIPR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgtttccactgatttttgcttttgtgctctacagtattagccaatttagt
ctatggaatgtcagccaatatttgagccacaatccgctccaagcctacttactttttccc
acaggcttacgcttggcggtctatttgttagctcgcccaacctatgtttgggtttggtta
ctgagtgacatgcttttggctggcgtgatcttggtgttgcttccagaccaatccagcccg
ttgatgctgctcatgccttgggtggtttggctagccgcagtcattgcccgccaacactgg
ccgaaattacatttgtattggcaaaagttactgctgattgtggcactggtgctgctgcac
actattttggtgggtatcacttttaccttgttggcgaaaccgctacacatgggggcggag
acgttaattgccgtgagtatcgcttcgctcacgggaggcattgtgctgaccccatttttg
tatctggtggccgactaccttagtcaccaaacttggcatccgctttctccacaactgatt
caccacgatgtgaaacttaaaccgaaaatgttgatgtggagcttactgtttttcagctta
ggactgctggcggagctgacgttacttgagcagatgaagccgtttgccctattgatcatc
ttgctcccgacgatttttcttgcctatcgttatggctggcaaggcggtgtattggcgagc
agtttaaactgcattctgctagcgacggcacgccagttcagtggctccttttcttcggat
caagagctgctgatttttatgtcgagccaagcttttgtcgggcttggattgggtatcgcc
attagccgccagcatcagctcgctttattactgcaaaaaatgaacacccgcttagccaaa
gagctgcgtgaaaagcaagatctggcgcgccagctcgtttctgtggaagagcaaattcgc
aaatccgttgcccgcgaactgcacgatgagattggccaaaacattaccgcgattcaaatt
caatccatgctcgctgaacgtttagccagtaatgatcaagccaaacaagcggcttctagc
gtgcagtcgctcgccatgcgcattcatcaatccacacgtcagctcttaaagcaactacgc
ccgcacattttggatgaactcgggttagaacatgccattcgtcagctggtgcaagaaatg
cgttttgccgaacaaggtatgacagttcgcctcaatatgggggtcaatccgcaaaagctg
gacgataccacgcgagtcactctgtatcggattgtgcaggagttgctgaacaacatttgc
aaacatgccaaagccacccgcgtacacatcagcctatttccgggaagtgaaatggttttg
gaagtcaaagacgatggcattggtttgcctaccgactggcgggtgcgtgggcacggctta
aaaggattgagtgagcgtgtatccgcactcggcggtcaattaaagatgacttcatccact
ttccaaactggcacgcgaataattgttaacttacccacaaaacgctcaataaccagcgaa
aaactaggaaatattcctagatga

DBGET integrated database retrieval system