KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0699Help
Entry
VCA0699           CDS       T00034                                 

Gene name
glgC
Definition
(RefSeq) glucose-1-phosphate adenylyltransferase
  KO
K00975  
glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCA0699 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    VCA0699 (glgC)
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     VCA0699 (glgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:637339..638562
Genome map
AA seq 407 aa AA seqDB search
MQDTLAVILAGGMGSRLSPLTDDRAKPAVPFGGKYRIIDFTLTNCLHSGLRRILVLTQYK
SHSLHKHLRNGWSIFNPELGEFITVVPPQMRKGGKWYEGTADALFHNMWLLARSDAKYVV
VLSGDHIYRMDYAAMLEEHISKNATLTIACMQVPRHEASAFGVMAIDDDSRITCFVEKPA
DPPCIPNRPDHSLASMGIYIFNMDVLKKALTEDAEIEQSSHDFGKDVIPKLIATGSVFAY
SFCSGKGRVARDCYWRDVGTIDSFYDANMDLLQPVPPMNLYQKNWAIRTYEQQYPPARTV
SSATGNEGIFINSIIANGVINSGGSVQHSIISSNVRINDSALIVDSILFDDVEVGEGCKL
IHCIIDKHVKIPPYTEIGLNPIEDRKRFHISERGVVVVPESYQFSTE
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacactttagctgtgattctcgcaggaggaatgggctcacgcctttccccgctg
acggatgacagagccaagcccgctgtaccttttggtggaaaatatcggattatcgatttc
accttaaccaattgcctgcattctggattacgccgcatcttggtgttaactcaatacaaa
tcgcactccttacataaacatcttcgtaatggctggtccatattcaatcccgagcttggt
gaattcatcaccgtggtgccgccgcaaatgcgtaagggaggaaaatggtacgaaggaacc
gccgatgcgctgtttcacaatatgtggctacttgcgcgtagtgatgccaaatacgtcgtg
gtgctttctggtgatcacatctatcgcatggattatgctgccatgctcgaagaacacatc
agcaaaaatgccactttaaccattgcctgtatgcaagtgcctcgacatgaagcctctgcg
tttggcgtgatggcgattgatgacgactctcgtattacctgctttgttgaaaagcccgcg
gatcccccttgtatccccaacagacccgatcacagtttagcctcgatggggatttatatt
ttcaatatggatgtactgaaaaaagcattaaccgaagatgctgaaattgagcaatccagc
cacgactttgggaaagacgtcattcctaaattgatcgcgacaggcagtgtctttgcctac
tcgttctgctctggtaaaggccgcgtcgctcgggattgctattggcgagatgtcggaacc
atagactctttctatgatgccaatatggatttgttgcagcccgttccgcccatgaatttg
tatcaaaaaaactgggcaatccgcacttatgagcagcagtacccgccagcaagaaccgtt
tcatcggccacgggtaacgaagggatttttatcaattcaatcattgctaacggcgtcatc
aactcgggcggctcggtgcaacattcgatcatctcttccaatgttcgcatcaatgattct
gcgctgatcgtcgacagtattttgtttgatgatgttgaagtgggcgaagggtgtaagctc
attcattgcattatcgataaacacgtaaaaattccgccctataccgaaattggccttaat
cctatcgaggatagaaaacgctttcatatctcagagcgaggcgttgttgtcgtaccagaa
agttatcagttttcgaccgagtag

DBGET integrated database retrieval system