KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0704Help
Entry
VCA0704           CDS       T00034                                 

Definition
(RefSeq) phosphoglycerate transport system transcriptional regulatory protein PgtA
  KO
K08476  two-component system, NtrC family, phosphoglycerate transport system response regulator PgtA
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch02020  Two-component system
Module
vch_M00503  PgtB-PgtA (phosphoglycerate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCA0704
Two-component system [BR:vch02022]
 NtrC family
  PgtB-PgtA [MD:M00503]
   VCA0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Sigma54_activ_2 Sigma54_activat HTH_8 ABC_tran AAA_5 DUF2851 AAA_16 FleQ Pro_CA HTH_17
Motif
Other DBs
NCBI-GeneID: 2612077
NCBI-ProteinID: NP_233091
UniProt: Q9KLN9
Position
II:complement(644568..645887)
Genome map
AA seq 439 aa AA seqDB search
MHWPLIWKKVQWLFWSYSKMKSTVLLIDDDQDVLDSYLHLMSIAGLTAKAVIDPTQAMSH
IQPDWNGVVLLDMYMPQLHGMELLKQIKAVDDKIPVIVITGHGDIPMAVEAVKMGACDFL
EKPINPPQLLTLIKQHLELRRSFIEQKLLLSRSVKRELVGKSAQMEQIRSHVAQYALLNR
HVVIVGESGCGRHTIAYLIHQLTTNNGHLPWVELVASAKTEWSTVEPKVQESAGGTLLID
HIELLSEEVQRNVVQSLLNQERLNRPRTRVIAVIDQPPEQLIAQNQLLPELYYLLNQGQI
DVPLLRQRPDDIAALFHYFLKQSCYKLGKPMPNVEPHYLALLRAHQWPGNVRELRNVAEL
YAIGIVKLAGKERLYNQEEMLSPLDELVDDYEKQVIEDALFLFSGRVADAANYLQVPRKK
LYLRMKKHGLEKDAFKARG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgcactggcctctaatttggaaaaaggtgcaatggttattttggagttacagcaagatg
aaaagtaccgtactgctgattgatgacgatcaggatgtgttggattcctacctacatttg
atgtcgattgccggattaaccgccaaagcggtgatcgatcctactcaagccatgagccac
atccaacccgattggaatggcgtcgtgctgctggatatgtacatgcctcaactgcatggc
atggaattgctcaagcagatcaaagccgtagacgacaaaattccggtcatcgtgatcaca
ggacacggtgatatcccgatggcggtggaagcggtcaaaatgggcgcgtgtgattttctc
gaaaaaccgatcaatcctccgcaattgctcacgctgatcaagcaacatcttgagctgcgt
cgctcgttcatcgagcaaaagctgctgttatcccgttcagtcaaacgtgaattagtcgga
aaatcagcacaaatggagcaaattcgctctcatgtggcgcaatatgcgctgctgaatcgc
catgtggtgatagtgggggagtcgggctgtgggcggcacaccatcgcctaccttatccat
caactgaccaccaataacggtcacttgccctgggttgagttagtcgcttcggccaaaacc
gagtggagtaccgttgaacctaaagtgcaagagagtgcgggtggaaccttgttgattgac
catattgagttgctcagcgaggaagtgcagcgcaatgtggtacagagtttactcaaccaa
gagcgactcaatcgccccagaacgcgagtgattgcggtgattgatcagccacccgagcag
ttaattgctcaaaaccagcttttgccagagctttactatttgctcaatcaagggcagatc
gatgtgcctttgttgcgtcaaagacccgatgacattgcggcgctgtttcactacttccta
aaacagagctgctataagctcggcaaacccatgcccaatgttgagccgcattatcttgcc
ttgttgcgcgcccaccaatggccggggaatgtgcgcgagctgcgtaatgtggcggagttg
tatgcgattggcattgtaaaactggcgggcaaagagcgtctctacaatcaagaagagatg
ctgtcgccattggatgagctggtggacgattacgaaaagcaagtgattgaagatgcgctg
tttctgttttctggccgagtagccgatgccgcgaactacctacaagtgccgcgtaaaaag
ctctatctgagaatgaaaaagcatggtttagagaaagatgcgtttaaagcccgaggttag

DBGET integrated database retrieval system