KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0708Help
Entry
VCA0708           CDS       T00034                                 

Definition
(RefSeq) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCA0708
   00620 Pyruvate metabolism
    VCA0708
  Nucleotide metabolism
   00230 Purine metabolism
    VCA0708
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     VCA0708
Membrane trafficking [BR:vch04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    VCA0708
Exosome [BR:vch04147]
 Exosomal proteins
  Proteins found in most exosomes
   VCA0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:651241..652701
Genome map
AA seq 486 aa AA seqDB search
MCKTKIVATLGPASQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVS
VGVLVDLQGPKIRIACFAEGAIQLSAGDTFILDGHLDGQAGTQERVGLDYPELIDDLNVG
NILLLDDGRIQLEVTAVDMQARLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDI
ITAAELQADFLAVSFPRNAEDIEYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRA
SDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVL
DVANAVIDGTDAIMLSAESAAGRYPVETVQAMVRIAQGVEHETHCAQNCWDALQHLCSDA
GKSFALSSMISASKVNKDLGVAIVTEQGETPLLMSRCQSQATIWAVSDKPALLRKLAILR
GVTPTYFPHLDKQGDIATQLIHLLRKPAQEKKIASILVTQLESVEGVGHVNVCRLLNLAQ
QEALFA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaaccaaaattgtggccactttaggccctgctagccaaactcgtgaaactttg
actcaactcatccaagctggcgtgaacgtggttcgcttgaacttttctcacggcagcgct
gaagaacacattgctcgcgcggaaatggtgcgtgagatcgcgcagcagctcaatgtgagc
gttggcgtactggttgatctacaaggccctaaaattcgtatcgcttgctttgcagaaggc
gcgattcaactctctgcaggcgacacatttattcttgatggccatttagatggtcaagcc
ggtacgcaagagcgcgtgggtttagactacccagaactaattgatgatctaaacgtaggc
aacatcctgctcctcgatgatggccgcattcaactggaagtcacggccgtcgatatgcaa
gctcgccttgttcacaccatcgcactcaatagtggcaaactgtccaaccgtaaaggcatt
aacttgcttggcggcggtctttccgctccggctctcacagaaaaagacaagctcgacatt
attactgcggcggagctgcaagccgacttcttagccgtctctttcccacgcaatgcggaa
gatattgaatacgcgcgccaactcgccactcaagcaggctgccatgcgcacattgtcgcc
aaagttgagcgcgcagaagtggtagccagtgaagaagcgatggacagcgttattcgcgcg
tctgatgtgatcatggtggcgcggggtgatttgggcgtggaaattggtgatgctcgtttg
ccaagcgtacaaaaagcgctgatcgcgcgtgctaagcacttaggtaaacctgtcatcacc
gccacgcaaatgatggaatcgatgatcgaaaacccactgccgacacgcgcagaagtcttg
gatgtcgcgaatgcggtgattgatggtactgatgcgatcatgctttctgcggaatcggcc
gcgggacgctaccctgtggaaacagtgcaagccatggtgcgcatcgcccaaggggttgag
cacgaaactcactgtgcgcaaaattgttgggatgcgctacaacatctgtgcagcgatgcg
ggcaaaagctttgctctgtcatcgatgatttcagcatccaaagtcaataaagatctcggt
gttgcgattgtgactgagcaaggtgaaacgccgcttttgatgtcacgctgtcaaagccaa
gccaccatttgggcggtgtctgataaacctgcgctactgcgtaagcttgctattttgcgt
ggtgtcacaccgacctatttcccacatttagataagcaaggtgatattgcgactcagctg
attcatttgctgcgtaaacccgcacaagagaaaaaaatcgcctcgattttggtcactcaa
ctggaatcggtcgaaggggttggtcacgtcaacgtgtgccgactactgaatttggcgcag
caggaagccctgttcgcctaa

DBGET integrated database retrieval system