KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0711Help
Entry
VCA0711           CDS       T00034                                 

Gene name
mgsA
Definition
(RefSeq) methylglyoxal synthase
  KO
K01734  methylglyoxal synthase [EC:4.2.3.3]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00640  Propanoate metabolism
vch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VCA0711 (mgsA)
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.3  methylglyoxal synthase
     VCA0711 (mgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MGS
Motif
Other DBs
NCBI-GeneID: 2612037
NCBI-ProteinID: NP_233098
UniProt: Q9KLN2
Position
II:656909..657364
Genome map
AA seq 151 aa AA seqDB search
MKKTTRTMAAHKHVALVAHDNCKGELLRWVTENKEKLQRHFLYATGTTGHMLSKETGLAI
KSMISGPMGGDQQLGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRIASVWNIPVATNR
ASAKFLFSSSLMEQEVQIEIPDYQAYLAERT
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccacccgcactatggcagcgcacaaacacgttgctcttgtggctcacgat
aactgcaaaggtgaactgctgcgctgggtaacagagaacaaggaaaaactgcaacgccat
ttcctgtatgccactggcaccacggggcatatgctcagtaaagaaacgggactggcgatc
aaaagtatgatcagcggcccaatgggcggtgatcagcaactgggcgcgttaatttctgaa
ggcaaaattgatgtgctgattttcttttgggatccacttaatgccgttccgcatgatccg
gatgtgaaagcgctgctgcgtatcgccagtgtgtggaatattcccgtcgccaccaaccgc
gccagtgctaaattcttgttttcttcttctttgatggagcaggaagtgcaaattgaaatt
ccggattaccaagcttatctcgctgaacgcacctaa

DBGET integrated database retrieval system