KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0712Help
Entry
VCA0712           CDS       T00034                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:vch00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(657433..658053)
Genome map
AA seq 206 aa AA seqDB search
MSKALLLVDVQNDFSPSGALPVPDGDAVVPVINQLLPLFEHVIATKDWHPAKHASFASVQ
GKTPGEVIDLNGIPQVMWPDHCVQNTHGAEFIAGLDVQRITHIVTKGTHLDVDSYSGFFD
NQRFHATGLAEYLSNQGISEVYIAGLATDYCVKYTALDAVSLYFKTWVIQDACRGVELNA
GDCATAWHAMQTAGCQLITSQQLLAG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcacttctgttagttgatgtccaaaatgatttttcacccagcggtgcgctg
cctgtgccggatggcgatgcggtcgtccctgtgattaatcaattgcttccgctctttgaa
catgtgattgccaccaaagattggcacccagccaaacacgcgagttttgcgtccgtgcag
gggaaaactccgggcgaagtcattgaccttaatggcattccacaagtgatgtggcctgat
cactgcgtgcaaaatacccatggtgcagaatttatagctgggttagatgtgcagcgaatt
acgcacattgtcaccaaaggcacccatcttgatgtggacagctacagtggtttttttgat
aaccaacgtttccatgctaccggattggccgaatacttgagtaatcagggaatttcagag
gtttacattgcaggtttggcgaccgactactgtgtgaaatataccgcgctggatgcagtt
tccctctactttaaaacttgggtcattcaggatgcgtgtcgaggtgtggaactgaatgcg
ggcgattgcgcgacagcgtggcacgcgatgcaaacggcagggtgtcagttgatcacttct
cagcagttgcttgccggttaa

DBGET integrated database retrieval system