KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0717Help
Entry
VCA0717           CDS       T00034                                 

Gene name
helD
Definition
(RefSeq) DNA helicase IV
  KO
K03658  
DNA helicase IV [EC:3.6.4.12]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Enzymes [BR:vch01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VCA0717 (helD)
DNA repair and recombination proteins [BR:vch03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    VCA0717 (helD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
II:complement(659756..661819)
Genome map
AA seq 687 aa AA seqDB search
MQLNANKTAQFFIANEYYQVQLEKEWLVLTSLSSEERIPFHVWNGEVQIRRGVFWGTLQF
FAHPEEGVQRSWLVQGLPWPECRHFAHQLVAHYQAWHNRQCEQLSLYFPRWQQELSRLKR
LPSFLSHSSVEAWVAQVYADLKLMDMTLHEAQKHLPTVFDTLLPWLLDTSATLYERNKAW
LEIERANWTVLFSQCESSPLNVSQQYAVLLNDDHNLVLAGAGSGKTSVLTARVSYLLQSH
LAKPEQILLVAFARDAAQEMAERLKNKIGLEAERLHINTFHQLGLRIINRVEGKTVIMSP
LANDSKLKQAWCIDWLKRHWMTPTNFKRWQKHLAKWPIAYLAGDDELGSHVENPKLIAWL
EKQLDQLAQMGLSKKELQERLVDHDDYPRLNSELSLCWPCYQAWQQMLKDQNQIDFNIMI
TRATEYVEKGKFRSPWKFIMVDEYQDISPQRLRLLQALCEQNQGQCNLFAVGDDWQSIYQ
FAGSDVDLTTGFASRFAHSTVHHLDTTYRFNDQIGAVANRFIQQNPHQLPKTLNSFKTQK
QKAVMLAPNHSVEKILDEINRSTNKLKTVLLLGRNHYHKPELLKDWQNRYLSLKLDFMTC
HASKGKEADYVIILAVDEGQFPARVKALHLDDALNQSEDDFPYAEERRLFYVALTRAKEK
VWVTYNGNGSSFVQELLNDDYPVVKQK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaatgcgaataagactgcacaattttttattgccaatgaatattaccaagtc
cagcttgagaaagagtggttggtgttaacttcgctcagtagcgaagaacgtattcccttt
catgtctggaacggtgaagtgcagatccgcagaggcgtgttttggggaacgttgcagttt
tttgctcatcccgaagagggcgtgcagcgcagttggctggtacaaggtcttccttggccg
gagtgtcgccattttgcgcaccaattagtggcgcattatcaagcgtggcacaatcgccaa
tgtgagcaattaagtctctattttccgcgttggcagcaagagttgtctcgtctaaagcgc
ctgccgtcttttctatcccactcctccgttgaagcttgggtcgcgcaagtgtatgccgat
ttaaaactgatggacatgacgctgcatgaagcgcaaaaacatcttcccacggttttcgat
accttactgccttggctgctcgatacctccgcgacgctgtatgagcgtaataaagcttgg
ctagagatagaacgcgcgaactggacagtcttgttttcccagtgtgaatcgtcgccgctc
aatgtctcgcagcaatacgctgtgctgctgaatgacgatcataacttagtgttggcgggc
gcaggttcaggtaaaaccagcgtactgactgcgcgcgtttcctatttattgcagagccat
ttggcgaaaccagagcaaattttgttggtcgcttttgcacgcgatgcggcacaagagatg
gccgagcgcttaaaaaacaaaattggtttggaagctgagcgtttgcacatcaataccttc
catcagttgggtctgcgcattatcaaccgagtggaaggcaaaacggtgatcatgtcgcca
ctcgcgaatgacagcaaactcaagcaggcttggtgtattgattggttaaagcgccactgg
atgaccccgactaattttaaacgctggcaaaaacatctcgccaaatggccgattgcgtat
ctggcaggggatgatgagctgggtagccacgtcgaaaacccgaaattgatcgcatggctc
gagaagcagctcgatcaattggcacaaatgggattgagtaaaaaagagctgcaagagcgg
ctggtggatcacgatgactatccacgcttaaacagcgagctttccttatgctggccgtgc
tatcaagcgtggcagcagatgcttaaagatcaaaaccaaattgatttcaacatcatgatc
actagagcgaccgagtatgtcgaaaaaggcaaattccgctcgccgtggaaatttatcatg
gttgatgagtatcaagacatctcgccgcagcgtttacgcttgctacaagcgctgtgtgag
caaaaccaaggccagtgtaacctgtttgcggtcggtgatgattggcaatccatctaccaa
tttgcgggttccgatgtggatttgaccaccggttttgcgtcgcgttttgcgcattcgacg
gtgcaccatctcgatactacttatcgttttaatgatcagattggtgcggtcgccaaccgc
tttattcagcaaaatccgcatcagttacccaaaacgctcaatagctttaaaacccagaag
caaaaagcggtcatgctggcaccgaaccattcggttgaaaaaatattggatgaaatcaat
cgctccaccaataagctgaaaaccgtgctactgcttggtcgtaatcactaccataaacct
gaattactgaaagattggcagaatcgctatctctctctcaagctcgattttatgacttgc
catgccagcaaaggcaaagaggcggattatgtgattattttggcggtcgatgaaggccaa
ttccccgctcgcgtgaaagctttgcatttggatgatgcgttgaatcaaagtgaggatgat
ttcccgtatgccgaagagcggcgcttattctatgtcgcgttgactcgtgccaaagagaaa
gtgtgggtgacttataacggcaacggctccagctttgttcaagagctgttgaatgatgac
tatccggttgttaagcaaaaatag

DBGET integrated database retrieval system