KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0720Help
Entry
VCA0720           CDS       T00034                                 

Definition
(RefSeq) guanylate cyclase-like protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNOB V4R
Motif
Other DBs
NCBI-GeneID: 2611992
NCBI-ProteinID: NP_233107
UniProt: Q9KLM3
Position
II:complement(665137..665712)
Genome map
AA seq 191 aa AA seqDB search
MKTSASEAIQMQGIIYTVLSDMVIEKFGVLFWDQMLEDLKPSSEGVYTSGQQYNDDELLA
MVGYLSEKAQIPAPDLVRAYGEYLFTHLFNSLPENYPHKSDLKTFLLSVDKVIHKEVQRL
YPDAYLPQFENRVEEKTLTMSYYSKRQLCAAAEGLILGAAKQFNQPVKITQPVCMHCGAD
HCEIVVEFLPS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagcgcaagtgaggcaatccagatgcaaggcattatctataccgttctctcc
gatatggtgattgaaaagtttggtgtgctgttttgggaccagatgctagaagatttgaaa
cccagctcagaaggggtgtatacctctggtcagcaatacaacgacgatgagctactggcc
atggtgggttatttgagtgagaaagcccaaatccctgcgcctgatttagtccgtgcttat
ggtgaatacctgtttacccatttatttaatagcttgccggaaaactacccgcataaaagc
gatctcaaaaccttcctgctttcggtggataaagtgatccacaaagaagtgcagcgactc
tatcccgatgcttacttgcctcagtttgaaaaccgagtggaagagaaaacgctgaccatg
agttactactcgaaacgacaattgtgcgcggcggcggaagggttaattttaggcgcggcc
aagcaatttaatcagccggtaaaaattactcagcccgtctgcatgcattgcggggctgat
cactgtgagattgtagtggaatttttgccatcatga

DBGET integrated database retrieval system