KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0726Help
Entry
VCA0726           CDS       T00034                                 

Definition
(RefSeq) molybdenum ABC transporter substrate-binding protein
  KO
K02020  
molybdate transport system substrate-binding protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
ABC transporters
Module
Molybdate transport system
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    VCA0726
Transporters [BR:vch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    VCA0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(669750..670514)
Genome map
AA seq 254 aa AA seqDB search
MPMLTRILLLLCVALNAPLASAKETLHIYAASSMTNAVNALVADYSQQHDVKLVTVYGGS
SSLARQIEAGAPADLFISANEEWANYLVEKGLVKPNKVVTLAANSLVLIRPTAQPVASFE
LQDAAAWQTALADSRLAVAQVDAVPAGMYAKQALQHAGVWPELESRLAQTNNVRLALALV
ERGESPLGIVYKTDALLSDKVTIVTAFSAQSHQPIRYPLAQLNDKAASAEWVAYLRSDAA
QQILQRFGFESVSE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgttgacacgaattctgctcctgctgtgtgtggcgcttaacgcgccgctggcg
agcgcgaaagagacactgcacatttacgcggcctcgtcgatgaccaatgccgtcaatgcg
ttagtggccgactactcacagcagcatgatgtgaagctggtgacggtgtacggcggctct
tcttcgctggcgcgtcaaattgaagcgggcgcacctgcggatctgtttatttccgccaat
gaagagtgggcgaattacttagtcgagaaaggcttagtgaaaccgaacaaggtggtgacg
ttggcggcgaatagtttggtgctgattcgcccgactgcacagccggtggcaagttttgag
ctgcaagatgccgcggcttggcaaacggccttggccgattctcgcttggcggttgcgcaa
gtggatgcggtgccggcgggcatgtatgccaagcaagcgctacaacatgcgggggtgtgg
cctgagctggaatcacgccttgcgcaaaccaataacgtgcgtttggcgctagcgttggtc
gagcgtggtgaatcgccgcttggcatcgtgtacaaaaccgatgcgctgctcagtgataaa
gtgacgatcgtgacggcattttcagctcagtctcaccagccgatccgctatccgctggcg
caattgaatgataaagcggcgagcgccgaatgggtggcgtatttacgctcagacgccgcg
cagcaaatcttgcaacgttttggttttgagtcggtgagtgagtaa

DBGET integrated database retrieval system