KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0728Help
Entry
VCA0728           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
II:complement(672577..674748)
Genome map
AA seq 723 aa AA seqDB search
MGNNIDTIQSIGLENFKGYRALEDGGPKELDFTIAGQAADLILVTGKNGVGKTSLLEAMD
WVLNQSNVGAGGFITTKESKGAVSINGKRFELNGKAKTDHKKLSTIASFFYQENIAGLAC
DEIIQLLEPENKPGEEIKRSLKALQAKLEDWQRQLHTLKYRKNYDEERKTLAGRVNELVD
KLPHDLPFRQLLVDSTLTLKNGNLQNKWDSQIRNLSSSIGNFSNLAEPIGSQLPDQLSHI
GHSLLEYRGRQVDFSEKGNELPAFTKEFLSTIQSLPAELVIKKLSEDTILAPSELENTLF
VGSDTDIYADKVDELEKQRIELTNEYQRLNKLQAQLQGDENSILTWIDGFTDNVSSWLEA
WDEHPDISDVIDLKQGLQVQLEKLSTLTTARSVEIRGKIEKVIERGQVVTASLNQIKRSQ
VVVRDINAHSNQLSQLLNEPNLTVEGLTDYVSNYLETIKTPVAEGASVVSETDIIHQLGR
VFTNWSALEIQKVEDEANAIDWDGLEHAEKMITDALAISKQESSAKSQLLSAVEVIPQAE
LDQLLKNMNQLLASFHFPDDFLPIELKNDGTPKIPKWGFKTKSGVQFDDLSTGQKSQLAI
CWTINLNLALSEQLGHRVIGFDDFTTSLDMNQLIPAAVLLRKLAYADANDSWKRQVIVTS
HHEDLTNRMLDFLLPPQGKLMKVIQFEDWQPESGPIFKCYNVDMGKVKEDGLQDAVKRIV
QTT
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaacaatatcgatactattcagtctataggactggaaaatttcaaaggctaccga
gctttagaagatgggggccccaaagagcttgattttacgatagcaggtcaagctgccgac
cttattttggtgacgggtaaaaacggggtaggtaaaacttctttgttagaagcaatggac
tgggtacttaatcagtctaatgttggtgcaggtggttttataaccactaaggagagcaag
ggtgcggtatctataaatggcaagaggtttgagcttaacggtaaggctaaaactgaccat
aagaaactcagtacaatagcctcatttttttatcaagaaaatattgctgggcttgcatgt
gacgaaatcattcaactattagagcctgaaaacaagccgggcgaagagattaagcggagc
ttgaaggcgttacaagcaaagttagaagactggcagcgccagctacatacgctgaagtat
agaaaaaactatgacgaagaaagaaaaactctcgctggaagagttaatgagcttgtcgat
aagctccctcacgatctgccgtttcgtcagttgttagtcgatagtacgttgaccttaaag
aatggcaacctacaaaataaatgggattctcaaatccgcaacctttctagctccatcgga
aacttcagtaacttggctgaaccgataggatcacaacttcctgaccagttgagccatatt
gggcatagtttgttggagtatcgaggccgtcaggtcgatttttctgagaaaggaaatgaa
ctacctgcctttaccaaagaattcttatctactattcagtctttaccagcagaattggtc
ataaaaaagttgtcagaagatactatcttggccccctctgaactcgagaatactttgttc
gtaggctctgatactgacatttacgctgataaagtagatgaactagagaaacaacggatt
gagttaaccaacgaataccaaaggcttaataaactacaagcgcagctgcaaggagacgaa
aactcgatcttaacttggattgatggctttactgacaatgttagtagctggttagaggct
tgggacgagcatcctgatatttcagatgttattgatttgaaacaggggttacaggttcaa
ttggaaaaattgtcgacattgacgactgcacgttctgttgaaatcagagggaagatagag
aaggttatcgaaagagggcaagttgttaccgctagtctcaatcagataaagcgctctcag
gtggttgtgagagatataaatgctcattcaaatcagctttcacaacttctaaatgaacct
aaccttactgttgaggggttaactgactatgttagtaattatcttgaaacgataaaaact
ccagttgcagagggtgcttcagtcgtttctgaaaccgatattattcatcagcttggcagg
gtgtttactaactggtcagctttagagatccagaaggtagaagacgaagccaacgcaatt
gattgggatggtttagagcacgcagagaaaatgatcaccgatgctctggctataagtaaa
caggaatcgagtgcaaaaagtcagttgctatcagctgttgaggtaataccgcaagctgaa
cttgatcaattgttaaaaaacatgaatcagcttcttgcaagcttccattttcccgatgat
tttctgcctatcgagcttaaaaacgatggcactccgaaaataccaaagtggggttttaag
acgaagtctggtgtacagttcgacgatctatcaactggtcaaaaatcccagctagcaatt
tgttggacaataaacttaaacttggccttgtcagaacaattaggccatagggttattgga
tttgatgactttactacttctcttgatatgaaccagctaattcctgctgccgtactgctt
cgcaagctggcgtacgccgatgctaacgatagctggaaaaggcaggtcattgtgaccagt
caccatgaagatttgacgaaccggatgcttgactttttgcttccccctcaaggcaagtta
atgaaagtaatccagtttgaagactggcaaccagaatcagggccgatttttaagtgctat
aacgtggatatgggtaaggtgaaagaagacggcctacaagacgcggttaagcgtattgtt
caaaccacttaa

DBGET integrated database retrieval system