KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0783Help
Entry
VCA0783           CDS       T00034                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vch01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:726843..727490
Genome map
AA seq 215 aa AA seqDB search
METNLDSDCAEMMDVCMTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSL
LAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQT
VTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQ
VILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtggagactaatttggatagtgattgcgctgaaatgatggatgtttgcatgactcgacta
ctttcctttttgtttgttgttctcttttctgctgcagccagcagtaaaacgttattggta
ctcggcgacagtttaagcgcagggtacgaaatgcctatcgaacaagcttggccaagttta
ctggccgaagagctagtggaacagggtcaaaccgttaccgtagttaacggaagcatttct
ggtgataccacaggcaacgggctcgcccgcctgccctctcttctgagccaacatcagccc
gataccgtactgatagaattaggagccaacgacggtttacgcggttttccaccgcaaacg
gtcactcataacctcaccaccatgattgaacagatccaagctaaaaacgcaaaagtcatc
ttaatgcagatccgtatcccacctaactatggcaaacggtacagcgatgcgttttaccag
atctatcctagcctagctgagcagttttctatcccgcttatcccgttctttcttgagcaa
gtgatcctcaaaccagaatggatgatggcagatggtttacaccccaaacctgaagcgcag
ccttggatagccaagtttgtggccgaacaccttgccgcacatttgtaa

DBGET integrated database retrieval system