KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0783Help
Entry
VCA0783           CDS       T00034                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VCA0783
Enzymes [BR:vch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VCA0783
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VCA0783
Lipid biosynthesis proteins [BR:vch01004]
 Fatty acid synthase
  Component type
   VCA0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:726843..727490
Genome map
AA seq 215 aa AA seqDB search
METNLDSDCAEMMDVCMTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSL
LAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQT
VTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQ
VILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtggagactaatttggatagtgattgcgctgaaatgatggatgtttgcatgactcgacta
ctttcctttttgtttgttgttctcttttctgctgcagccagcagtaaaacgttattggta
ctcggcgacagtttaagcgcagggtacgaaatgcctatcgaacaagcttggccaagttta
ctggccgaagagctagtggaacagggtcaaaccgttaccgtagttaacggaagcatttct
ggtgataccacaggcaacgggctcgcccgcctgccctctcttctgagccaacatcagccc
gataccgtactgatagaattaggagccaacgacggtttacgcggttttccaccgcaaacg
gtcactcataacctcaccaccatgattgaacagatccaagctaaaaacgcaaaagtcatc
ttaatgcagatccgtatcccacctaactatggcaaacggtacagcgatgcgttttaccag
atctatcctagcctagctgagcagttttctatcccgcttatcccgttctttcttgagcaa
gtgatcctcaaaccagaatggatgatggcagatggtttacaccccaaacctgaagcgcag
ccttggatagccaagtttgtggccgaacaccttgccgcacatttgtaa

DBGET integrated database retrieval system