KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0814Help
Entry
VCA0814           CDS       T00034                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vch00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(760423..761352)
Genome map
AA seq 309 aa AA seqDB search
MNDLFTKTDYSLYSNAMTFVRRPYVRNPVDTNADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNLFKKINVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
ALGGDHFITLPILRAYAKHFGEMALIHFDAHTDTYANGSAYDHGTMFYHAPKEGLISAKH
SVQVGIRTEYKQEGHGFNVINAMQANDMSVEEIVAQIRHIVGDKPVYLTFDIDCLDPAFA
PGTGTPVCGGLSSDKILKIIRALKGINLIGMDVVEVSPPYDQSDLTSLAGATIALELLYV
WASNKKDEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcactctactcaaacgcgatgacgtttgtc
cgtcgtccctatgtgcgtaacccagtagatactaatgctgatgtcgtggtacttggcgtg
cctttggatatggcgacgtccggtcgtccgggggctcgtatggggcctgacgcgattcgt
cgtgcttcggttaacctcgcttgggaaggtaagaaattcccttgggatttcaacctgttt
aaaaagatcaacgtgattgatgcgggcgatttggtttttgattgcggtgatgctgaagat
ttcacttaccgcctagaagccgcgaccagcgaaatcctgaaaagtggcaaaaccatgctg
gcactgggtggcgatcacttcatcactctgccaatcctgcgtgcttacgctaagcacttc
ggtgaaatggcgctgatccactttgatgcacacacggacacttacgcgaacggcagtgcg
tatgaccacggcaccatgttctaccatgcgccaaaagaaggtctgatctcggctaagcat
tcggtgcaagtgggtattcgtacggaatacaaacaagaaggccacggcttcaacgtgatt
aacgcgatgcaagccaacgacatgtctgtcgaagagattgtggcgcaaattcgccacatc
gtgggtgacaagccggtttacctgactttcgacattgactgtctggatcctgctttcgca
ccgggtacgggtacgccagtttgtggcggtttgagctcagacaagatcctgaaaatcatc
cgcgcgctgaaaggcatcaacctgatcggtatggatgtggtagaagtgtcacctccttac
gatcaaagcgacctgacttcactggcgggtgcgacgatcgctctggaactgctctacgtt
tgggcatccaacaagaaagatgaagagtaa

DBGET integrated database retrieval system