KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0956Help
Entry
VCA0956           CDS       T00034                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:904820..905839
Genome map
AA seq 339 aa AA seqDB search
MMTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGL
CPPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKD
LERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDA
LFDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKR
LQSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSIT
ASFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtaccttta
atgatgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtc
gaccaagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctt
tgcccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaacc
aatattaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatg
agtgatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggat
ttagagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgc
ttggtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaac
gcggcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgct
ctgtttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacg
ctgatccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagcc
cttaatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgt
cttcaaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgca
ctgattgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgt
tcaatagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattacc
gcttcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcga
gcggatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system