KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0956Help
Entry
VCA0956           CDS       T00034                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:904820..905839
Genome map
AA seq 339 aa AA seqDB search
MMTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGL
CPPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKD
LERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDA
LFDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKR
LQSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSIT
ASFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtaccttta
atgatgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtc
gaccaagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctt
tgcccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaacc
aatattaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatg
agtgatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggat
ttagagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgc
ttggtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaac
gcggcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgct
ctgtttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacg
ctgatccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagcc
cttaatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgt
cttcaaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgca
ctgattgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgt
tcaatagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattacc
gcttcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcga
gcggatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system