KEGG   Vibrio cholerae IEC224: O3Y_00480Help
Entry
O3Y_00480         CDS       T01766                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vci  Vibrio cholerae IEC224
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vci00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:100811..101854
Genome map
AA seq 347 aa AA seqDB search
MSVSIQGQFPGRRLRRLRKHDFSRRLVAENQLSVNDLIYPMFILMGKDRREKVDSMPGVE
RLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPQ
MGVITDVALDPFTTHGQDGIIDEQGYVLNDETTEVLVKQALSHAQAGADVVAPSDMMDGR
IGRIRQALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSSANLKGGNKKNYQMDPANSDE
ALHEVAMDINEGADMVMVKPGMPYLDVVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWL
KERETVFESLLCFKRAGADGILTYFAKEVAEWLAEDSAKAAQFLPKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtatccattcaaggtcaatttcctgggcgtcgtttacgccgcctgcgtaaacat
gatttcagccgtcgccttgtggccgaaaaccagttgtcggtgaacgatctgatctacccg
atgtttattttgatgggtaaagatcgccgtgaaaaagtcgattccatgccgggcgtagaa
cgtttatccatcgatttaatgctggaagaagcacagtatctcgctaacctcggtgtgcct
gcgattgctctgtttcctgtggtcaatcaggatgcaaaaagcctatgtgctgccgaagct
tacaaccctgaaggcttagttcaacgcgcagtgcgtgcgctgaaagagcatgtgccgcaa
atgggcgtgatcactgatgtggcattggatccattcacaactcatggacaagacggcatc
atcgatgagcaaggttatgtgttgaatgatgaaacaacggaagtgctagtgaagcaagca
ctgtcgcatgctcaagctggtgcggatgtggttgccccttccgatatgatggatggccgt
attgggcgcattcgtcaagcattggaagaggcggggtacattcatactcaaatcatggct
tattccgctaaatatgcctcgaattactatgggccattccgtgatgcggtcgggtcatct
gcgaatttaaaaggtggcaacaagaaaaactaccaaatggaccccgccaattccgatgaa
gctttgcatgaagtcgcgatggacatcaatgaaggtgcggacatggtgatggtgaagccc
ggcatgccctatctagatgtggtgcgccgtgtcaaaaccgagttgcaggtaccgaccttc
gcttaccaagtttccggtgagtatgcgatgcacaaagcggcaatcatgaatggttggttg
aaagagcgggaaacggtattcgaatctttactctgcttcaaacgtgcaggtgcagatggc
attttgacttactttgcgaaagaggtggctgagtggttggcggaagacagcgcaaaagcc
gcgcagttcttacctaaaaagtaa

DBGET integrated database retrieval system