KEGG   Vibrio cholerae IEC224: O3Y_00605Help
Entry
O3Y_00605         CDS       T01766                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:vci00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(129657..130673)
Genome map
AA seq 338 aa AA seqDB search
MNPEKNLYPYTQESSLEQALNFEIAQVWHTRSEGTYRSFDKTHIYWCSLKHPEHQKAVVI
VNGRIESAWKYQELCYDLFRQGFDVYTYDHRGQGRSERLTEDRQIGHVHEFQDYVTDLKA
LVEHFDLGHYQERFLLAHSMGGAIATRYIQTTPAHPFSALALSAPMFGVNMPWYLRPWAL
LITQIMAAVTLKPSYAPGYGPYHAKPFHLNLLTHSETRYQLFRELYEAHPELQIGGPSHR
WVWQSLMATKQCLQLTRQIKIPMLILQAGEEAIVCNRAQIRLFKKLSRTQKRAALCRIAG
ARHELLFEQDAYRNQTLDHILRFFADSTIDHKRQHHRP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgaaaaaaatctttatccttatacgcaagagtcgagtttggagcaagctctc
aactttgagatagctcaagtgtggcacactcgaagcgaaggaacctatcgcagttttgat
aaaacgcacatttattggtgtagtctcaagcatcctgagcatcaaaaagccgtagtgatt
gtgaatggcaggattgaatctgcgtggaaatatcaagagctgtgttatgacctattccgc
caaggttttgatgtttatacctatgatcaccgtggtcaaggacggtcagaacgtctgact
gaagatagacaaataggccatgtacatgagtttcaagattacgtgactgacttaaaagcc
ttagtcgagcatttcgatctcggtcactaccaagagcgctttttattagcccattctatg
ggtggcgcgattgctacgcgctatatccagaccactccagcgcacccctttagcgcactg
gccctgagtgctccgatgtttggcgtgaatatgccttggtatttaaggccatgggctttg
ctcatcactcaaattatggctgccgttaccctaaaacccagttacgctccgggttatggc
ccttatcacgctaaaccctttcatctcaacctgctcacccacagtgaaacccgctatcag
ttgtttcgtgaactgtatgaagcgcaccctgaactgcaaattggagggccgagtcaccgc
tgggtttggcagagcttaatggcgaccaaacagtgtttgcagttaacccgacaaatcaaa
atccccatgctgatcttacaagctggcgaagaagcgattgtgtgtaatcgggcgcaaatc
cggctcttcaaaaagctgtctcgcacccaaaaacgtgccgctttatgccgcatagcagga
gccagacatgaactgctttttgaacaagatgcctaccgaaatcagacgttagaccatatt
ttgcgttttttcgccgacagtactatcgaccataaaagacagcaccatcgaccatag

DBGET integrated database retrieval system