KEGG   Vibrio cholerae IEC224: O3Y_01120Help
Entry
O3Y_01120         CDS       T01766                                 

Definition
GDP-mannose 4,6-dehydratase
Orthology
K01711  
GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
vci  Vibrio cholerae IEC224
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vci00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vci00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:249334..250455
Genome map
AA seq 373 aa AA seqDB search
MNKKVALITGITGQDGSYLAEFLLEKGYEVHGIKRRSSLFNTQRVDHLYKDPHEEDVNFK
LHYGDLTDSSNLTRILAEVQPDEVYNLGAQSHVAVSFQSPEYTADVDAIGTLRLLEAIRF
LGLTKKTKFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKMYAYWITINYRESYGIYA
CNGILFNHESPRRGETFVTRKITRGMANIAQGLEKCLFMGNLDALRDWGHAKDYVKMQWM
MLQQDEPRDFVIATGVQYSVREFIDMSARELGIELEFVGKGVDEKAVVKSVIGTKAPAIK
VGDIIVAVDPAYFRPAEVETLLGDPSLAKKELGWVPEITLQQMVSEMVASDLEQAQSHAL
LKKHGYNVNVSVE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagttgcgttaatcacaggcattactggacaagatggttcttatctagcg
gagtttttgctagaaaaagggtatgaagtacatggaattaaaagacgttcatctttattc
aatacacaacgtgttgatcatctttacaaagacccacatgaggaagatgtaaatttcaaa
ctacattacggagaccttacggattcctctaacttgactcgtatattagcggaagtacag
ccagatgaagtctataacttgggcgcgcagtcccatgtggcggttagtttccagtcaccg
gaatatacagcggacgtagatgctattggaactttaaggctactagaagcaatcagattt
ttaggtttgacgaaaaaaactaagttttatcaagcctcaacttcagagctttatggctta
gtacaagaaatacctcagaaagaaactacccctttttatcctagaagcccttatgctgtg
gcaaagatgtatgcgtattggataacaattaattatagagaatcgtacggaatatacgcg
tgtaatggcatactttttaaccacgaatcccctagacgaggagaaacttttgtaactcgc
aaaataactcgggggatggcaaacattgcgcaagggttagaaaaatgcctttttatggga
aatttggacgctcttcgagattgggggcatgctaaagattacgttaagatgcaatggatg
atgttacagcaagatgaacctagagattttgttattgctacaggtgtacagtatagcgta
agagagtttattgatatgtcagcacgagaactaggcattgagttagaatttgtcggtaag
ggtgtagatgaaaaagctgtagtgaagtcagttattggaacgaaagctcctgcaatcaag
gttggtgacattattgtagctgtggatcctgcatattttagacccgcagaggtagaaacg
ctgttaggtgatcctagcctagctaagaaggagcttggatgggtgccagaaattacttta
caacagatggtttctgaaatggtagcttctgatttagaacaagctcaaagtcatgcacta
ttgaaaaaacatggctataacgtaaatgtatctgtagagtga

DBGET integrated database retrieval system