KEGG   Vibrio cholerae IEC224: O3Y_01120Help
Entry
O3Y_01120         CDS       T01766                                 

Definition
GDP-mannose 4,6-dehydratase
Orthology
K01711  
GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
vci  Vibrio cholerae IEC224
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O3Y_01120
   00520 Amino sugar and nucleotide sugar metabolism
    O3Y_01120
Enzymes [BR:vci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     O3Y_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:249334..250455
Genome map
AA seq 373 aa AA seqDB search
MNKKVALITGITGQDGSYLAEFLLEKGYEVHGIKRRSSLFNTQRVDHLYKDPHEEDVNFK
LHYGDLTDSSNLTRILAEVQPDEVYNLGAQSHVAVSFQSPEYTADVDAIGTLRLLEAIRF
LGLTKKTKFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKMYAYWITINYRESYGIYA
CNGILFNHESPRRGETFVTRKITRGMANIAQGLEKCLFMGNLDALRDWGHAKDYVKMQWM
MLQQDEPRDFVIATGVQYSVREFIDMSARELGIELEFVGKGVDEKAVVKSVIGTKAPAIK
VGDIIVAVDPAYFRPAEVETLLGDPSLAKKELGWVPEITLQQMVSEMVASDLEQAQSHAL
LKKHGYNVNVSVE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagttgcgttaatcacaggcattactggacaagatggttcttatctagcg
gagtttttgctagaaaaagggtatgaagtacatggaattaaaagacgttcatctttattc
aatacacaacgtgttgatcatctttacaaagacccacatgaggaagatgtaaatttcaaa
ctacattacggagaccttacggattcctctaacttgactcgtatattagcggaagtacag
ccagatgaagtctataacttgggcgcgcagtcccatgtggcggttagtttccagtcaccg
gaatatacagcggacgtagatgctattggaactttaaggctactagaagcaatcagattt
ttaggtttgacgaaaaaaactaagttttatcaagcctcaacttcagagctttatggctta
gtacaagaaatacctcagaaagaaactacccctttttatcctagaagcccttatgctgtg
gcaaagatgtatgcgtattggataacaattaattatagagaatcgtacggaatatacgcg
tgtaatggcatactttttaaccacgaatcccctagacgaggagaaacttttgtaactcgc
aaaataactcgggggatggcaaacattgcgcaagggttagaaaaatgcctttttatggga
aatttggacgctcttcgagattgggggcatgctaaagattacgttaagatgcaatggatg
atgttacagcaagatgaacctagagattttgttattgctacaggtgtacagtatagcgta
agagagtttattgatatgtcagcacgagaactaggcattgagttagaatttgtcggtaag
ggtgtagatgaaaaagctgtagtgaagtcagttattggaacgaaagctcctgcaatcaag
gttggtgacattattgtagctgtggatcctgcatattttagacccgcagaggtagaaacg
ctgttaggtgatcctagcctagctaagaaggagcttggatgggtgccagaaattacttta
caacagatggtttctgaaatggtagcttctgatttagaacaagctcaaagtcatgcacta
ttgaaaaaacatggctataacgtaaatgtatctgtagagtga

DBGET integrated database retrieval system