KEGG   Vibrio cholerae IEC224: O3Y_01820Help
Entry
O3Y_01820         CDS       T01766                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vci  Vibrio cholerae IEC224
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3Y_01820
   00052 Galactose metabolism
    O3Y_01820
   00500 Starch and sucrose metabolism
    O3Y_01820
   00520 Amino sugar and nucleotide sugar metabolism
    O3Y_01820
Enzymes [BR:vci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     O3Y_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(420644..421516)
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGKH
SIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELVG
DEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKDD
LFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcgact
aagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgtt
gatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcat
tcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaat
aaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttatt
cgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggt
gatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgta
ctggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagag
gttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgat
ctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctc
gccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagaccgag
ccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcgggt
tgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctat
atcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggag
ttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system