KEGG   Vibrio cholerae IEC224: O3Y_02480Help
Entry
O3Y_02480         CDS       T01766                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vci  Vibrio cholerae IEC224
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vci00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:558025..558531
Genome map
AA seq 168 aa AA seqDB search
MITAYIGVGSNQDRHQSIEAGLRALAELASQWRLSTIYECPSVGFASHPFFNLMVEMETE
LALPELMKQLKAIELRCGRLPNAQKYQDRTLDLDIVLYGDCVSENDPVLPRPDIYRYPFV
IQPLYELCPQRVIAGDGRTVEQIWQQAQDLASLTPVPIWFSINEKKQS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgcttatattggtgtgggctcaaatcaggatcgccatcagtcgattgaagct
ggccttcgtgcattagccgagctggcgagccagtggcgtctgtccacgatttatgagtgt
ccatccgttgggtttgccagccatcctttcttcaatctgatggttgagatggagacagag
ctcgcgctgcctgaattgatgaagcagttaaaagcgatcgagctgcgttgtggccgtttg
ccgaatgcacaaaagtatcaggatcgaacactggatcttgatattgtgctgtatggcgat
tgtgtatcggagaatgatccagtgctgcctcgaccggatatctatcgctatccgtttgtg
attcaacctttatatgagctctgtccgcagcgagtgattgctggtgatggtcgaactgtt
gagcagatttggcaacaagcgcaggatttagcatcactcaccccagtaccaatctggttt
tctattaacgagaagaaacaatcatga

DBGET integrated database retrieval system