KEGG   Vibrio cholerae IEC224: O3Y_02975Help
Entry
O3Y_02975         CDS       T01766                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vci  Vibrio cholerae IEC224
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vci00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:677159..677995
Genome map
AA seq 278 aa AA seqDB search
MLKISHADKQLELHSPVVMGILNTTPDSFSDGGRYVDLDVALARAQQMIDLGVAIIDIGG
ESTRPGAPDVALEEELQRVIPLIKAIRKQNAEVWISIDTSKAEVMRQALAAGADLINDVR
ALQEPGALEVAAQAQVPVCIMHMQGQPRTMQANPHYYNIIEEVCQFLAERIAQCEAAGIK
RENIILDPGFGFGKSVQHNYHLLAHLEQFHRFGLPVLAGMSRKSMIFKTLNKQPAECVAG
SVACATLAAQKGAQIIRVHDVEQTIDALKMVQMMHNNL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatcagtcatgccgataagcagcttgagctgcattcacccgttgtgatgggt
atcttaaatactacgccagattccttttccgatggcggccgttacgttgaccttgatgtc
gcgttggcaagagcacagcaaatgatcgaccttggcgtcgcgattattgatattggcggt
gagtcaactcgaccaggcgctcctgatgttgctttagaagaggaattacagcgcgtcatc
ccacttatcaaagcgattcgaaaacagaatgctgaggtatggatttcgattgataccagc
aaagcggaagtgatgcgccaagcattagctgcgggagccgatctgattaatgatgtgcgt
gctttgcaagagccgggagctcttgaagtagcagcgcaggctcaagtcccggtttgtatt
atgcatatgcaaggtcagccgcggacgatgcaagctaacccacactactacaatattatt
gaagaggtttgccagtttttagctgagcgaattgcacaatgcgaagctgcgggtattaag
cgtgagaatattatcttagatcccggttttggttttggaaaatcggtgcaacacaattat
catttgctcgcccatttagaacagtttcatcgttttggattgccagttttagctggaatg
tcacgtaaatcaatgatttttaaaacactgaataagcaaccagctgaatgtgtggcagga
agcgttgcgtgtgccacattggctgcgcaaaaaggcgcacaaattatccgtgttcatgat
gtagagcagaccattgatgcactcaaaatggtgcagatgatgcataacaatttgtaa

DBGET integrated database retrieval system