KEGG   Vibrio cholerae IEC224: O3Y_03420Help
Entry
O3Y_03420         CDS       T01766                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vci  Vibrio cholerae IEC224
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3Y_03420
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3Y_03420
   00630 Glyoxylate and dicarboxylate metabolism
    O3Y_03420
Enzymes [BR:vci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     O3Y_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:785999..787636
Genome map
AA seq 545 aa AA seqDB search
MSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCERFAPRVDELLT
LREQKQTLIDQGQLPDFLPETKDIREGSWKILGIPDDLQDRRVEITGPTDRKMVINALNA
NVKVFMADFEDSMSPAWDKVLDGQINLRDAILGSISYTNPDNGKRYELNANPAVLICRVR
GLHLKEKHVTYNGLAIPGSLFDFALYFYNNHRALLKKGSGPYFYLPKLQAYQEAQWWSDV
FHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRWDYIFSYIKTLK
KHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPALNEQVLQK
IRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMADAPITAAELLAP
CDGSRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKTL
DNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTSQELPNFLTIPG
YDYLP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcaatactgctgaattaacccaacacaccacggaaaccaaaatcacccaaggc
aagcttgctgttgtgggtaccctttcacccgaacatcaagcgattttccctgtcgaagcc
caaacttttttacagcaactctgtgagcgctttgcgccgcgagtggatgaattactgacc
ttgcgtgaacaaaaacaaacgcttatcgaccaaggccagctacctgattttcttcctgaa
accaaagatatccgtgaaggaagctggaagattctcggcattccagacgatctgcaagat
cgtcgcgtagagatcacggggccaaccgatcgcaaaatggtgattaatgcactgaacgcg
aatgtgaaagtctttatggctgactttgaagattcgatgtcgcccgcgtgggataaggtg
ttggatgggcagatcaacctgcgtgatgcgattctgggcagcataagctataccaaccca
gacaatggcaagcgttatgagctcaatgccaacccagcggtgctcatctgccgcgtgcgc
ggtctgcatctcaaagaaaaacatgtcacctacaacggcttggcgattcccggttcactg
ttcgattttgcgctctatttttacaacaaccatcgcgcactattgaaaaaaggcagtggc
ccttatttctacctacctaagctgcaagcttatcaagaggcgcagtggtggagtgacgtg
ttccatttcacggaagattattttggcttagacacaggcaccatcaaagcaacggtgttg
attgaaactctgcctgcggtatttcagatggatgagatcctcttctcactcaaagagcac
attgtcggtctgaactgtggacgctgggattatattttcagctacatcaaaaccttgaaa
aagcatcccgaccgcgtattgccggatcgccaagtggtgaccatggataagcctttcctc
aatgcgtattcccgtttgttgatttacacctgtcataaacgcggcgcgtttgcgatgggc
gggatggcggcgtttattccagccaaagatcctgcgctcaatgaacaagtgctacaaaaa
attcgcggcgacaaaatgcttgaagcgaccaatggccacgatggcacttgggttgctcac
cccggtttagcggataccgcgatggcggtgtttaacgaagtgcttggtgagcgcaaaaac
caactcaatgtgagccggatggccgatgctccgataaccgcggccgagctattggcacct
tgcgatggatcacgctctgagcatggcatgcgccacaacattcgcgttgcgttgcaatac
atcgaagcatggatttctggtaacggttgtgtgccgatctacggcttgatggaagatgcg
gcgacagcggagatttcacgcgcttcgatttggcaatggatccaacacggcaaaacgtta
gataacgggcaagtggtcactaacgaactgtttcgcgactacctcaaacaagagattgag
gtggtgaaaagcgaagtgggtgagtcccgttttgcacaagggcgttttactgaagcggcc
gaattgatggagcgcttaacgaccagccaagagctaccgaatttcttaaccatacctggc
tacgactacttgccgtag

DBGET integrated database retrieval system