KEGG   Vibrio cholerae IEC224: O3Y_03420Help
Entry
O3Y_03420         CDS       T01766                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vci  Vibrio cholerae IEC224
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3Y_03420
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3Y_03420
   00630 Glyoxylate and dicarboxylate metabolism
    O3Y_03420
Enzymes [BR:vci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     O3Y_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:785999..787636
Genome map
AA seq 545 aa AA seqDB search
MSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCERFAPRVDELLT
LREQKQTLIDQGQLPDFLPETKDIREGSWKILGIPDDLQDRRVEITGPTDRKMVINALNA
NVKVFMADFEDSMSPAWDKVLDGQINLRDAILGSISYTNPDNGKRYELNANPAVLICRVR
GLHLKEKHVTYNGLAIPGSLFDFALYFYNNHRALLKKGSGPYFYLPKLQAYQEAQWWSDV
FHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRWDYIFSYIKTLK
KHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPALNEQVLQK
IRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMADAPITAAELLAP
CDGSRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKTL
DNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTSQELPNFLTIPG
YDYLP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcaatactgctgaattaacccaacacaccacggaaaccaaaatcacccaaggc
aagcttgctgttgtgggtaccctttcacccgaacatcaagcgattttccctgtcgaagcc
caaacttttttacagcaactctgtgagcgctttgcgccgcgagtggatgaattactgacc
ttgcgtgaacaaaaacaaacgcttatcgaccaaggccagctacctgattttcttcctgaa
accaaagatatccgtgaaggaagctggaagattctcggcattccagacgatctgcaagat
cgtcgcgtagagatcacggggccaaccgatcgcaaaatggtgattaatgcactgaacgcg
aatgtgaaagtctttatggctgactttgaagattcgatgtcgcccgcgtgggataaggtg
ttggatgggcagatcaacctgcgtgatgcgattctgggcagcataagctataccaaccca
gacaatggcaagcgttatgagctcaatgccaacccagcggtgctcatctgccgcgtgcgc
ggtctgcatctcaaagaaaaacatgtcacctacaacggcttggcgattcccggttcactg
ttcgattttgcgctctatttttacaacaaccatcgcgcactattgaaaaaaggcagtggc
ccttatttctacctacctaagctgcaagcttatcaagaggcgcagtggtggagtgacgtg
ttccatttcacggaagattattttggcttagacacaggcaccatcaaagcaacggtgttg
attgaaactctgcctgcggtatttcagatggatgagatcctcttctcactcaaagagcac
attgtcggtctgaactgtggacgctgggattatattttcagctacatcaaaaccttgaaa
aagcatcccgaccgcgtattgccggatcgccaagtggtgaccatggataagcctttcctc
aatgcgtattcccgtttgttgatttacacctgtcataaacgcggcgcgtttgcgatgggc
gggatggcggcgtttattccagccaaagatcctgcgctcaatgaacaagtgctacaaaaa
attcgcggcgacaaaatgcttgaagcgaccaatggccacgatggcacttgggttgctcac
cccggtttagcggataccgcgatggcggtgtttaacgaagtgcttggtgagcgcaaaaac
caactcaatgtgagccggatggccgatgctccgataaccgcggccgagctattggcacct
tgcgatggatcacgctctgagcatggcatgcgccacaacattcgcgttgcgttgcaatac
atcgaagcatggatttctggtaacggttgtgtgccgatctacggcttgatggaagatgcg
gcgacagcggagatttcacgcgcttcgatttggcaatggatccaacacggcaaaacgtta
gataacgggcaagtggtcactaacgaactgtttcgcgactacctcaaacaagagattgag
gtggtgaaaagcgaagtgggtgagtcccgttttgcacaagggcgttttactgaagcggcc
gaattgatggagcgcttaacgaccagccaagagctaccgaatttcttaaccatacctggc
tacgactacttgccgtag

DBGET integrated database retrieval system