KEGG   Vibrio cholerae IEC224: O3Y_05460Help
Entry
O3Y_05460         CDS       T01766                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    O3Y_05460
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3Y_05460
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3Y_05460
Enzymes [BR:vci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     O3Y_05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
I:complement(1240079..1241269)
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEFGGQFVPQILVPALDQLEQAFIDAQQDDAFRAEFMSLLQEYAGRPTALTL
TQNITKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSATLKDACNEALRDWSASY
ETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGIEPAGKGIHTHQHGAPLKHGKTGIFFGMKAPLMQDEHGQVEESYSVS
AGLDFPSVGPQHAYLNAIGRAEYESITDDEALDAFQALARNEGIIPALESSHALAHAIKM
AYAEPDKEQLLVVNLSGRGDKDIFTVHKLLEDKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaaacgcctattttggcgaattcggtgggcagtttgtgccacaaattttg
gttccggcactcgatcaactggaacaagcttttattgatgcccagcaggatgatgctttt
cgcgctgaatttatgagcctactgcaagagtacgcgggtcgccccactgcgctgacactc
acgcaaaacatcaccaaaggcaccaaaaccaaactctatttgaagcgtgaagatctactg
cacggcggcgcgcacaaaaccaaccaagttttgggccaagccctgctcgccaaacgtatg
ggcaaacatgaaattatcgccgagacaggcgcaggtcaacacggtgtcgcaaccgcatta
gcctgtgcactgcttggcctaaaatgccgcgtgtacatgggtgcaaaagacgttgagcgc
caaagcccaaacgtgttccgtatgcgcttaatgggtgccaccgtgatccctgttcattca
ggttcagcaacgctaaaagatgcctgtaacgaagcgctgcgtgactggtcagccagctat
gaaactgcgcattatctgctcggtactgcggcaggccctcacccattcccaaccatagtg
cgtgaattccaacgcattattggtgaagaaaccaaaaaccaaatccttgctcgtgaaggt
cgtttgcccgatgcggtgatcgcttgtgtcggtggcggctcaaacgcgattggtatgttt
gccgatttcatcgaagaagaatccgtacgtttgatcggtattgagccagcaggtaaaggc
attcatacccatcaacatggtgcaccactcaaacacggtaaaactggtatcttcttcggc
atgaaagcaccgttgatgcaagatgaacatggtcaagtggaagagtcttactctgtctct
gcggggctggatttcccatcggtgggtccacaacatgcttacctcaacgccattggtcgt
gcggaatatgaaagcattaccgatgatgaagcactcgatgcgttccaagcgttggcacgt
aacgaaggcatcattccagcgctggagtcttcacacgctctcgcgcatgcaatcaaaatg
gcgtatgccgaaccagacaaagagcagttgctcgtggttaacctttcgggccgaggtgat
aaggatattttcaccgtacacaaattacttgaagacaaaggagcgttgtaa

DBGET integrated database retrieval system