KEGG   Vibrio cholerae IEC224: O3Y_05465Help
Entry
O3Y_05465         CDS       T01766                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01130  Biosynthesis of antibiotics
vci01230  Biosynthesis of amino acids
Module
vci_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3Y_05465
Enzymes [BR:vci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     O3Y_05465
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     O3Y_05465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFC57973
Position
I:complement(1241310..1242719)
Genome map
AA seq 469 aa AA seqDB search
MSEQLSEHISVQTAQMAQVLVKIVNDKYQWIEERKAKQPLASFHPLLTRSERDFYQALSG
DNTVFILECKKASPSKGLIREEFDLDYIASVYGEYASAISVLTDEKYFQGRFEFLPQVRA
QVAQPVLCKDFMVDPYQVYLARHYQADAILLMLSVLNDDQYRELAAVAHDLGMGVLTEVS
NEQELKRAVDLQAKVIGINNRNLRDLTTDLNRTKQLAPLIPQGTIIISESGIYTHQQVRD
LAEFANGFLIGSSLMAQSNLELAVRKIVLGEHKVCGLTHPDDAVKAYQAGSVFGGLIFVE
KSKRFVDVEQARLTMSGAPLQYVGVFQNHPAAQVADIATKLGLFAVQLHGEEDSAYVSEL
RASLPESIEIWKAYGVSDALPELLPEHIDRHLLDAKVGEQSGGTGRSFDWRLLPKHSDLM
LAGGLSAENVAQAAQLGCRGLDFNSGVESAPGKKDANQLQQVFQQLRNY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagttgtctgagcatatttccgtacaaaccgcgcaaatggcgcaagtgctg
gtcaaaatcgtcaacgataaataccaatggattgaagagcgcaaagccaagcaacctctt
gctagctttcatccattactgactcgctcagagcgcgatttctatcaagccttgagcggc
gataacaccgtattcattctcgaatgcaaaaaagcctcaccttcaaaaggattgatccgc
gaagagtttgatctcgattacatcgcctctgtgtatggcgagtacgccagtgccatttcg
gtactgactgacgagaaatatttccaaggtcgttttgagtttttgccgcaagtgcgcgct
caagtggctcagcctgtcttgtgcaaagattttatggtcgacccgtatcaggtttatctg
gcgcgtcattatcaagcggatgcgattttgctgatgctgtctgtgctcaatgatgatcaa
tatcgtgaactggctgctgtggcgcacgaccttggtatgggcgtactcaccgaagtcagc
aacgaacaagaattgaaacgtgcagttgatctgcaagcgaaagtcatcggcatcaataac
cgcaatctgcgtgatttgaccaccgacctaaatcgcaccaagcagttggcgccgctcatt
ccacaaggcaccatcattatttccgaatccggtatttatacccatcagcaggtgcgtgat
ttggctgaatttgccaatggtttcttgattggtagctcgctgatggcgcaaagcaatctt
gaactggcggtgcgaaaaattgtgctaggtgaacataaggtgtgcggtttgactcatcct
gatgatgcggtgaaagcctaccaagccggttccgtttttggtggattgatttttgttgag
aagtccaaacgctttgtcgatgtagaacaagctcgcctgaccatgagcggcgcgccgcta
cagtatgtcggcgtgtttcaaaatcacccagcagcacaagtcgccgatattgcaaccaaa
cttggcttatttgcggtgcaactgcacggtgaggaagactctgcgtatgtaagcgaactg
cgcgcttcccttccagaatccattgaaatttggaaagcgtatggcgtgagtgatgcttta
cctgagctactaccagagcacatcgataggcatctgctcgatgccaaagtcggcgaacag
agtggcggcacaggacgcagttttgattggcgcttgctgccaaaacatagcgacctgatg
ctcgccggcggcttgagcgccgagaatgtcgcccaagcggcgcaacttggctgccgcgga
ctcgatttcaactctggcgtggaaagcgctccgggtaaaaaagacgccaaccagttacaa
caggttttccaacagttacggaattattag

DBGET integrated database retrieval system