KEGG   Vibrio cholerae IEC224: O3Y_06775Help
Entry
O3Y_06775         CDS       T01766                                 

Definition
cholera enterotoxin, A subunit
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
vci  Vibrio cholerae IEC224
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(1564367..1565143)
Genome map
AA seq 258 aa AA seqDB search
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagataatatttgtgttttttattttcttatcatcattttcatatgcaaatgat
gataagttatatcgggcagattctagacctcctgatgaaataaagcagtcaggtggtctt
atgccaagaggacagagtgagtactttgaccgaggtactcaaatgaatatcaacctttat
gatcatgcaagaggaactcagacgggatttgttaggcacgatgatggatatgtttccacc
tcaattagtttgagaagtgcccacttagtgggtcaaactatattgtctggtcattctact
tattatatatatgttatagccactgcacccaacatgtttaacgttaatgatgtattaggg
gcatacagtcctcatccagatgaacaagaagtttctgctttaggtgggattccatactcc
caaatatatggatggtatcgagttcattttggggtgcttgatgaacaattacatcgtaat
aggggctacagagatagatattacagtaacttagatattgctccagcagcagatggttat
ggattggcaggtttccctccggagcatagagcttggagggaagagccgtggattcatcat
gcaccgccgggttgtgggaatgctccaagatcatcgatgagtaatacttgcgatgaaaaa
acccaaagtctaggtgtaaaattccttgacgaataccaatctaaagttaaaagacaaata
ttttcaggctatcaatctgatattgatacacataatagaattaaggatgaattatga

DBGET integrated database retrieval system