KEGG   Vibrio cholerae IEC224: O3Y_08215Help
Entry
O3Y_08215         CDS       T01766                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vci  Vibrio cholerae IEC224
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    O3Y_08215
  Lipid metabolism
   00561 Glycerolipid metabolism
    O3Y_08215
   00600 Sphingolipid metabolism
    O3Y_08215
Enzymes [BR:vci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     O3Y_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1869668..1870792)
Genome map
AA seq 374 aa AA seqDB search
MSHLRLANGREILVQQADIELEIAGNELFARYIGLHNRPFERRYPLFSTLLDVESDARLV
GDGFQMLSQASGTLSHIQEVGRCPDNNLSYRIYPHDAPKRFYNTLMIEAAGRYLLFGFTS
CQRFAGFFEVHRHPQHWVLSAFIDGEETRPQDWITNQLESVICLEGESMSELYQAYAEAI
SRQHPPRPHLKDPAPMGWCSWYAYYAEVTEQDIKENVAILAERHPELEWVLLDDGYQAFM
GDWLTPSQKFPSGIEQVIADIRAQGKKPAIWLAPFIAEADSAVFRQHPDWFVKNAAGQPL
KAEEITYGGWRCTPWYVLDCSHPDVQEHLTQVVKTLREEWGVELFKLDANYWGTLQGQRF
QSGVTGVEAYRMGM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagccatctcagattagcgaatgggcgagaaatcctagtgcagcaagcggatattgag
ctggagatcgcaggcaatgagctttttgcacggtatatcgggttacacaatcgacctttt
gagcgccgttatccactgtttagcactttactggatgtcgaatcggatgcccgcttagtg
ggggatgggtttcaaatgctgtcgcaagcctcaggtacgctaagccatatccaagaagtt
ggacgatgcccagataacaatctcagttaccgcatctatccgcatgatgcgccaaagcgt
ttttacaataccttgatgatagaggccgctggccgctatctgttgtttggctttacttct
tgccagcgttttgcgggcttttttgaagtgcaccgtcacccgcagcattgggtgttaagc
gcgtttattgatggagaggaaacccgcccacaagactggatcaccaatcagttggaatcg
gtgatttgcttagaaggcgagtccatgtcggagctttaccaagcctatgccgaggcgatt
tctcgccagcatccgccaagaccccatctcaaagatcccgcaccaatgggctggtgttct
tggtacgcttattatgcagaggtgaccgagcaagatatcaaagagaatgtcgcgatattg
gcggagcgtcacccagaattggaatgggtgctgctggatgacggctatcaagcctttatg
ggcgattggcttacgccatcccaaaaattccccagtggtattgagcaagtgattgccgat
attcgcgcacaaggtaaaaagcccgctatctggcttgccccttttatcgcggaagcggat
tcggcagtttttcgtcagcacccagactggtttgtgaaaaatgccgcaggtcagccactc
aaagccgaagagatcacttatggcggttggcgttgtactccttggtatgtgttggattgc
tctcatcctgacgtgcaagagcatttgacccaagtggtcaaaaccttacgtgaagagtgg
ggcgttgaactgtttaagctggatgccaactactggggaacgctacaaggccagcgtttt
caatccggtgttacgggtgtagaagcgtatcgaatgggcatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system