KEGG   Vibrio cholerae IEC224: O3Y_08215Help
Entry
O3Y_08215         CDS       T01766                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vci  Vibrio cholerae IEC224
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vci00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vci00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vci00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1869668..1870792)
Genome map
AA seq 374 aa AA seqDB search
MSHLRLANGREILVQQADIELEIAGNELFARYIGLHNRPFERRYPLFSTLLDVESDARLV
GDGFQMLSQASGTLSHIQEVGRCPDNNLSYRIYPHDAPKRFYNTLMIEAAGRYLLFGFTS
CQRFAGFFEVHRHPQHWVLSAFIDGEETRPQDWITNQLESVICLEGESMSELYQAYAEAI
SRQHPPRPHLKDPAPMGWCSWYAYYAEVTEQDIKENVAILAERHPELEWVLLDDGYQAFM
GDWLTPSQKFPSGIEQVIADIRAQGKKPAIWLAPFIAEADSAVFRQHPDWFVKNAAGQPL
KAEEITYGGWRCTPWYVLDCSHPDVQEHLTQVVKTLREEWGVELFKLDANYWGTLQGQRF
QSGVTGVEAYRMGM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagccatctcagattagcgaatgggcgagaaatcctagtgcagcaagcggatattgag
ctggagatcgcaggcaatgagctttttgcacggtatatcgggttacacaatcgacctttt
gagcgccgttatccactgtttagcactttactggatgtcgaatcggatgcccgcttagtg
ggggatgggtttcaaatgctgtcgcaagcctcaggtacgctaagccatatccaagaagtt
ggacgatgcccagataacaatctcagttaccgcatctatccgcatgatgcgccaaagcgt
ttttacaataccttgatgatagaggccgctggccgctatctgttgtttggctttacttct
tgccagcgttttgcgggcttttttgaagtgcaccgtcacccgcagcattgggtgttaagc
gcgtttattgatggagaggaaacccgcccacaagactggatcaccaatcagttggaatcg
gtgatttgcttagaaggcgagtccatgtcggagctttaccaagcctatgccgaggcgatt
tctcgccagcatccgccaagaccccatctcaaagatcccgcaccaatgggctggtgttct
tggtacgcttattatgcagaggtgaccgagcaagatatcaaagagaatgtcgcgatattg
gcggagcgtcacccagaattggaatgggtgctgctggatgacggctatcaagcctttatg
ggcgattggcttacgccatcccaaaaattccccagtggtattgagcaagtgattgccgat
attcgcgcacaaggtaaaaagcccgctatctggcttgccccttttatcgcggaagcggat
tcggcagtttttcgtcagcacccagactggtttgtgaaaaatgccgcaggtcagccactc
aaagccgaagagatcacttatggcggttggcgttgtactccttggtatgtgttggattgc
tctcatcctgacgtgcaagagcatttgacccaagtggtcaaaaccttacgtgaagagtgg
ggcgttgaactgtttaagctggatgccaactactggggaacgctacaaggccagcgtttt
caatccggtgttacgggtgtagaagcgtatcgaatgggcatgtaa

DBGET integrated database retrieval system