KEGG   Vibrio cholerae IEC224: O3Y_09660Help
Entry
O3Y_09660         CDS       T01766                                 

Definition
glucose-6-phosphate 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3Y_09660
Enzymes [BR:vci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     O3Y_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2199720..2200610
Genome map
AA seq 296 aa AA seqDB search
MDLLSLKTVTTLSDCVTIAEQDQVKIVRVIHDKASAAISLHGGHVLSFQPKGQADLLWMS
SQAIYDGKAALRGGIPVCWPWFGRIAAPAHGFARNQEWKLIEHRENEQGVIVTLGLQATP
ESLAIWPYQFDVRLHVEIRESLTVTLDVTNTDSKAWTFSGALHTYLHVGDIRETQTSGVG
TEYIDSLQNSRLCTQHGLLTLTDTIDRVYTQPEPLITVQDPALARTLTVENQGHNSAVLW
NPWQQGAQSMADMNDEGYLHFLCVESTLHAPSLAEGITLQPGQNHQLVTQITSQAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatttactctctttgaaaaccgtcacaacattatctgattgcgtcaccatagctgag
caagatcaagtcaaaatcgtacgcgtcattcatgacaaagccagcgccgctatctcacta
cacggtggccatgtcctctcctttcagccaaaaggtcaagctgacttgctgtggatgagc
tcacaagctatttacgatggcaaagccgcactacgcggtggtattccggtttgctggcca
tggtttggtcgtattgccgccccggcacatggttttgcacggaaccaagaatggaaactg
atcgaacacagggaaaatgagcaaggcgttatcgtcactctcggcttgcaagccacgcca
gagagcttagccatttggccatatcaatttgacgttcgattgcacgtggaaatccgtgag
agcttgactgtgacacttgatgtgactaacacggattcaaaagcatggaccttctctggg
gctctgcacacttatctgcacgtgggtgatattcgtgaaacgcaaacctcaggtgtggga
acggagtatattgatagcctacaaaacagtcgtctatgtactcagcacggtttgctcact
ctcactgacacgatagaccgtgtttacacgcaacccgaacccttgatcacagtgcaagac
cccgcattagctcgcacgctaaccgttgaaaatcaaggtcataactccgcggtgttgtgg
aatccttggcaacaaggtgctcaatcgatggccgacatgaatgatgagggttacttacac
tttttgtgtgtggaatcaacactgcatgcgccgtctttggcagagggtatcaccttacag
ccggggcaaaatcatcagctagtcactcaaatcactagccaagctcaatag

DBGET integrated database retrieval system