KEGG   Vibrio cholerae IEC224: O3Y_09965Help
Entry
O3Y_09965         CDS       T01766                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vci  Vibrio cholerae IEC224
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vci00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    O3Y_09965
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    O3Y_09965
Enzymes [BR:vci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     O3Y_09965
Two-component system [BR:vci02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   O3Y_09965
Bacterial motility proteins [BR:vci02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    O3Y_09965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2262778..2263911)
Genome map
AA seq 377 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGKEAVEKAARLKPDVITMDIEMPV
MDGISAVREIMANNPVPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNRDEAVT
LLQQRVLSIASKKMFLRRPAAPRPAPTTSIAASSSLSQERAAATSPLGNRPSTAVSAATR
FKASGKKYQLTAIGTSTGGPVALQKILTKLPVNYPHPIVLIQHMPATFTAAFASRLNSLC
KIEVKEAEDGDMLRPGVAYLAPGGKQMMLDGRPGAARLRIIDGGDRMNYKPCVDVTFGSA
AKIFGDKVLSMILTGMGADGREGARMLKQAGATIWAQDEESCVVYGMPQAVAKAGISTED
LPLERIAERMLVEVGLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtattagttgttgatgattcgagttttttccgtcgtcgcgtgagtgaa
atcatcaactccgaatcgcgcttagaagtcattgatgttgctgtaaatgggaaagaggcc
gtagaaaaggccgctcgactcaagccagatgtgatcactatggatatagaaatgcccgtc
atggacggtatttccgctgtccgagaaatcatggcaaacaatcccgtgcccattttgatg
ttctcttcattgacccatgatggcgcaaaagccacattggatgcactggatgctggcgcg
ttagactttttacctaagaagtttgaagatatcgcgcgcaaccgggatgaagccgtcaca
ctgttacagcagcgtgtgctttctattgcatcgaaaaagatgtttctacgtcgccctgca
gctccacgccctgcgcctacaacatcaatagcagcgagttcgtcactcagccaagaacga
gcggcagctacctcacctttgggaaaccgaccctcgacggcggtttcagcagccactcgt
tttaaagcttcgggtaaaaaataccagttgaccgcaataggaacctcaaccggtggacct
gtagccttgcaaaaaatattaactaagctccccgtaaattatccacaccccatagtgttg
attcagcatatgccagcaacatttacggctgcttttgctagccgtctcaattcgctatgc
aaaattgaagttaaagaagcggaagatggagatatgctgcgtccgggtgttgcttattta
gcaccgggtggtaagcagatgatgctggatggtcgacccggtgcggctcgcctacgtatt
atcgatggtggcgaccgcatgaactataaaccgtgtgtggatgttacttttggctccgca
gcgaaaatctttggtgacaaagtactgtccatgattttgaccggaatgggtgcggatgga
cgtgaaggtgcgcggatgctgaaacaagcaggagccaccatttgggcacaagatgaagaa
agttgtgtcgtgtatggcatgccacaagctgtcgctaaagcaggaatttcaacggaagat
ctaccgctggagagaatcgcagagcgtatgttggtagaagtcgggctcgcctaa

DBGET integrated database retrieval system