KEGG   Vibrio cholerae IEC224: O3Y_10095Help
Entry
O3Y_10095         CDS       T01766                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00020  Citrate cycle (TCA cycle)
vci00190  Oxidative phosphorylation
vci00650  Butanoate metabolism
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01130  Biosynthesis of antibiotics
vci01200  Carbon metabolism
Module
vci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vci_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3Y_10095
   00650 Butanoate metabolism
    O3Y_10095
  Energy metabolism
   00190 Oxidative phosphorylation
    O3Y_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFC58893
Position
I:complement(2298354..2298698)
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDYLLIRASAIILVLYTIYIVSFCAFTDISYVAWTQFFGSTFTKVFT
MLALVSVLIHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcatgtctcttcctttggtcgtaatggtgttcacgattacttattgatccgc
gcttcagcgatcatcttagttttgtacactatttatatcgtgagtttttgcgcgttcacg
gacatctcttatgtcgcgtggactcaattctttggtagcacgttcaccaaagtcttcaca
atgttggcattagtttcagtattgattcatggctggattggcctatggcaagtactgacg
gattacattaagtgctccaaattgcgtgcaggactgcaacttgtggtcatcgccgttcta
cttggatacttcttctctggcctatttgtattgtggggtgcctaa

DBGET integrated database retrieval system