KEGG   Vibrio cholerae IEC224: O3Y_10375Help
Entry
O3Y_10375         CDS       T01766                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vci  Vibrio cholerae IEC224
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vci01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vci00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2349578..2350711
Genome map
AA seq 377 aa AA seqDB search
MTDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS
PLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEH
PDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRR
GSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQA
GTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTG
ELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIAD
LEKLTDMYQKTLNHLLG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagccctgtactggctctggcaaaagagctgattagccgccaatccgttact
cctgccgacgcaggatgtcaggatctgatgattgagcgcttaaaagcgctgggtttcgaa
attgaaagcatggtgtttgaagacaccaccaacttctgggctcgccgcggcacgcaatct
cccctgtttgtttttgcaggtcataccgatgtggtgcctgccggccctttgtcgcagtgg
cacactcctccttttgagccgactgtgattgatggtttcctgcatgggcgtggcgcagca
gatatgaaaggctcgctggcttgtatgattgtggcggtagagcgttttattgccgaacat
cccgatcatcaaggctcaatcggttttttgatcacttctgatgaagaaggcccctttatc
aacggtaccgtccgtgtcgtagaaacgctaatggcacgtaacgaactgatcgatatgtgt
atcgtcggtgagccgtccagtaccctagccgtaggcgatgtggtgaaaaatggccgtcgt
ggctccatcacgggggatttgaaggtaaaaggcactcaaggccatgttgcttatccgcat
ctggctaataatcccgtgcataaagcgctccccgcattggccgaactcgccgccacccaa
tgggatgaaggtaacgcctatttcccccccaccagctttcaaattcctaacctgcaagcg
ggtactggcgcatcgaatgtcatccccggtgaatttgatgtgcagtttaacttccgcttt
agtacagagctcaccgatgaagagatcaaacgccgcgtacattcggtcttggatgctcac
gggctcgattacgatgtgaaatggactctcagcggccaacccttcctgaccgatacgggc
gaactactggccgcagtagtcgcggcagtagaggaagtaaaccatcaagctcctgcgtta
ttgacgacaggcggaacatctgatggtcgcttcattgcccaaatgggcgcacaagtggtt
gagctcggtcccgtcaatgccaccattcacaaggtaaacgagtgtgtacgtattgcggat
ttagagaaattgaccgatatgtatcaaaaaaccttaaatcatcttttaggctaa

DBGET integrated database retrieval system